BLASTX nr result
ID: Atropa21_contig00028091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00028091 (560 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG37655.1| integrase [Populus trichocarpa] 61 2e-07 gb|ABG37658.1| integrase [Populus trichocarpa] 58 2e-06 emb|CAN72235.1| hypothetical protein VITISV_032805 [Vitis vinifera] 56 7e-06 emb|CAN70715.1| hypothetical protein VITISV_004701 [Vitis vinifera] 56 7e-06 >gb|ABG37655.1| integrase [Populus trichocarpa] Length = 1263 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = +1 Query: 202 LTAQVASLTKQ--LQQNTMTANMVQRPYNNPFSNAYNPGWRNHPNFSWK 342 L A+ ASL ++ L + N QRP +NP+S YNPGWRNHPNFSWK Sbjct: 519 LQAKFASLARKECLHEQAHALNSFQRPNHNPYSQTYNPGWRNHPNFSWK 567 >gb|ABG37658.1| integrase [Populus trichocarpa] Length = 1139 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +1 Query: 220 SLTKQLQQNTMTANMVQRPYNNPFSNAYNPGWRNHPNFSWK 342 S + L + N QRP +NP+S YNPGWRNHPNFSWK Sbjct: 110 SFKECLHEQAHALNNFQRPNHNPYSQTYNPGWRNHPNFSWK 150 >emb|CAN72235.1| hypothetical protein VITISV_032805 [Vitis vinifera] Length = 1593 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +1 Query: 163 NTVQFGRLDAITALTAQVASLTKQLQQNTMTANMVQRPYNN-PFSNAYNPGWRNHPNFSW 339 N+ + GR+ A + L++ + A M +RP NN P+ N YN WRNHPNFSW Sbjct: 296 NSREMGRIKAPVNPKGGMYMLSEDMDMKAKVATMARRPNNNAPYGNTYNSSWRNHPNFSW 355 Query: 340 K 342 K Sbjct: 356 K 356 >emb|CAN70715.1| hypothetical protein VITISV_004701 [Vitis vinifera] Length = 2103 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +1 Query: 163 NTVQFGRLDAITALTAQVASLTKQLQQNTMTANMVQRPYNN-PFSNAYNPGWRNHPNFSW 339 N+ + GR+ A + L++ + A M +RP NN P+ N YN WRNHPNFSW Sbjct: 554 NSREMGRMKAPVNPKGGMYMLSEDMDMKAKVATMAKRPNNNAPYGNTYNSSWRNHPNFSW 613 Query: 340 K 342 K Sbjct: 614 K 614