BLASTX nr result
ID: Atropa21_contig00028087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00028087 (566 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357486.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 ref|XP_004243349.1| PREDICTED: pentatricopeptide repeat-containi... 109 5e-22 ref|XP_004243811.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 >ref|XP_006357486.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Solanum tuberosum] Length = 498 Score = 110 bits (276), Expect = 2e-22 Identities = 51/63 (80%), Positives = 58/63 (92%) Frame = +3 Query: 3 ILASRPGWRPHFHSLASCVKYLQSKGDTQREQQLKDLLRVRGLFPKEVEKGLNKYIEVGN 182 ILAS+PGW+PHFHSLASCVKYLQSKGDTQ E++LKDLLRVRGL KE E+GL+KYIE+GN Sbjct: 424 ILASKPGWKPHFHSLASCVKYLQSKGDTQGEEELKDLLRVRGLCSKEFERGLDKYIEIGN 483 Query: 183 RMS 191 R S Sbjct: 484 RKS 486 >ref|XP_004243349.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Solanum lycopersicum] Length = 493 Score = 109 bits (272), Expect = 5e-22 Identities = 51/63 (80%), Positives = 57/63 (90%) Frame = +3 Query: 3 ILASRPGWRPHFHSLASCVKYLQSKGDTQREQQLKDLLRVRGLFPKEVEKGLNKYIEVGN 182 ILAS+PGW+PHFHSLASCVKYLQSKGDTQ E++LKDLLRVRGL KE E GL+KYIE+GN Sbjct: 419 ILASKPGWKPHFHSLASCVKYLQSKGDTQGEEELKDLLRVRGLCSKEFEGGLDKYIEIGN 478 Query: 183 RMS 191 R S Sbjct: 479 RKS 481 >ref|XP_004243811.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Solanum lycopersicum] Length = 323 Score = 99.8 bits (247), Expect = 4e-19 Identities = 47/63 (74%), Positives = 54/63 (85%) Frame = +3 Query: 3 ILASRPGWRPHFHSLASCVKYLQSKGDTQREQQLKDLLRVRGLFPKEVEKGLNKYIEVGN 182 ILAS+PGW+PHF SLA CVKYLQSKGDTQ E++LKDLLRVRGL KE E+ L+KYIE+G Sbjct: 249 ILASQPGWKPHFQSLAFCVKYLQSKGDTQGEEELKDLLRVRGLCSKEFERSLDKYIEIGY 308 Query: 183 RMS 191 R S Sbjct: 309 RKS 311