BLASTX nr result
ID: Atropa21_contig00027580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00027580 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004234030.1| PREDICTED: magnesium transporter MRS2-I-like... 58 2e-06 ref|XP_006356053.1| PREDICTED: magnesium transporter MRS2-I-like... 57 3e-06 >ref|XP_004234030.1| PREDICTED: magnesium transporter MRS2-I-like [Solanum lycopersicum] Length = 399 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 MFKWVVIGSGIFCAVFFILIISYARYKGLVGS 98 MFKWVV SGI CAV F+LIISYARYKGLVGS Sbjct: 368 MFKWVVAVSGIICAVIFLLIISYARYKGLVGS 399 >ref|XP_006356053.1| PREDICTED: magnesium transporter MRS2-I-like isoform X1 [Solanum tuberosum] Length = 398 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 MFKWVVIGSGIFCAVFFILIISYARYKGLVGS 98 MFKWVV SGI CAV FILIISYAR+KGLVGS Sbjct: 367 MFKWVVAISGIICAVLFILIISYARFKGLVGS 398