BLASTX nr result
ID: Atropa21_contig00026162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00026162 (534 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245941.1| PREDICTED: probable polyamine transporter At... 74 2e-11 ref|XP_004245940.1| PREDICTED: probable polyamine transporter At... 74 2e-11 ref|XP_004245939.1| PREDICTED: probable polyamine transporter At... 74 2e-11 ref|XP_004245938.1| PREDICTED: probable polyamine transporter At... 74 2e-11 ref|XP_006364454.1| PREDICTED: probable polyamine transporter At... 72 8e-11 ref|XP_006364453.1| PREDICTED: probable polyamine transporter At... 72 8e-11 ref|XP_006359232.1| PREDICTED: probable polyamine transporter At... 62 6e-08 ref|XP_004245811.1| PREDICTED: probable polyamine transporter At... 62 8e-08 >ref|XP_004245941.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 4 [Solanum lycopersicum] Length = 467 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLPDITSHGPLIR 108 G+VLQPCIKLIE+KRWLKFSTSSDLPDIT+HGPLIR Sbjct: 432 GMVLQPCIKLIERKRWLKFSTSSDLPDITAHGPLIR 467 >ref|XP_004245940.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 3 [Solanum lycopersicum] Length = 481 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLPDITSHGPLIR 108 G+VLQPCIKLIE+KRWLKFSTSSDLPDIT+HGPLIR Sbjct: 446 GMVLQPCIKLIERKRWLKFSTSSDLPDITAHGPLIR 481 >ref|XP_004245939.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 2 [Solanum lycopersicum] Length = 482 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLPDITSHGPLIR 108 G+VLQPCIKLIE+KRWLKFSTSSDLPDIT+HGPLIR Sbjct: 447 GMVLQPCIKLIERKRWLKFSTSSDLPDITAHGPLIR 482 >ref|XP_004245938.1| PREDICTED: probable polyamine transporter At1g31830-like isoform 1 [Solanum lycopersicum] Length = 516 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLPDITSHGPLIR 108 G+VLQPCIKLIE+KRWLKFSTSSDLPDIT+HGPLIR Sbjct: 481 GMVLQPCIKLIERKRWLKFSTSSDLPDITAHGPLIR 516 >ref|XP_006364454.1| PREDICTED: probable polyamine transporter At1g31830-like isoform X2 [Solanum tuberosum] gi|565397765|ref|XP_006364455.1| PREDICTED: probable polyamine transporter At1g31830-like isoform X3 [Solanum tuberosum] Length = 467 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLPDITSHGPLIR 108 GLVLQPCIKLIE+KRWLKFSTSSDLPDIT+ GPLIR Sbjct: 432 GLVLQPCIKLIERKRWLKFSTSSDLPDITAQGPLIR 467 >ref|XP_006364453.1| PREDICTED: probable polyamine transporter At1g31830-like isoform X1 [Solanum tuberosum] Length = 481 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLPDITSHGPLIR 108 GLVLQPCIKLIE+KRWLKFSTSSDLPDIT+ GPLIR Sbjct: 446 GLVLQPCIKLIERKRWLKFSTSSDLPDITAQGPLIR 481 >ref|XP_006359232.1| PREDICTED: probable polyamine transporter At1g31830-like [Solanum tuberosum] Length = 468 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLP-DITSHGPLIR 108 GLV+QPC+KLIE KRWLKFS SSDLP DIT+H PL+R Sbjct: 432 GLVMQPCLKLIENKRWLKFSVSSDLPDDITTHEPLLR 468 >ref|XP_004245811.1| PREDICTED: probable polyamine transporter At1g31830-like [Solanum lycopersicum] Length = 468 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +1 Query: 1 GLVLQPCIKLIEKKRWLKFSTSSDLP-DITSHGPLIR 108 GLV+QPC+KLIE KRWLKFS SSDLP DIT+H PL+R Sbjct: 432 GLVMQPCLKLIENKRWLKFSISSDLPDDITTHEPLLR 468