BLASTX nr result
ID: Atropa21_contig00026006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00026006 (579 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359672.1| PREDICTED: thaumatin-like protein 1-like [So... 58 2e-06 ref|XP_004231023.1| PREDICTED: thaumatin-like protein 1-like [So... 58 2e-06 ref|XP_002277462.1| PREDICTED: SCUTL1 [Vitis vinifera] gi|147856... 56 8e-06 >ref|XP_006359672.1| PREDICTED: thaumatin-like protein 1-like [Solanum tuberosum] Length = 276 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +1 Query: 1 PYTSMKVLSLRKDSAELPLVNKTMMYIGRHH 93 PYTS KVL RKDSAELPLVNKTMMYIGR H Sbjct: 246 PYTSQKVLGARKDSAELPLVNKTMMYIGRRH 276 >ref|XP_004231023.1| PREDICTED: thaumatin-like protein 1-like [Solanum lycopersicum] Length = 276 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +1 Query: 1 PYTSMKVLSLRKDSAELPLVNKTMMYIGRHH 93 PYTS KVL RKDSAELPLVNKTMMYIGR H Sbjct: 246 PYTSQKVLGARKDSAELPLVNKTMMYIGRRH 276 >ref|XP_002277462.1| PREDICTED: SCUTL1 [Vitis vinifera] gi|147856671|emb|CAN81357.1| hypothetical protein VITISV_040406 [Vitis vinifera] gi|297744633|emb|CBI37895.3| unnamed protein product [Vitis vinifera] Length = 313 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 1 PYTSMKVLSLRKDSAELPLVNKTMMYIGRHHRSG 102 P+TS KVL+LR+++AELPLVNKTMMYIGR + SG Sbjct: 251 PFTSQKVLALRREAAELPLVNKTMMYIGRKYASG 284