BLASTX nr result
ID: Atropa21_contig00023705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00023705 (485 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350757.1| PREDICTED: phosphatidylinositol/phosphatidyl... 72 8e-11 ref|XP_006350756.1| PREDICTED: phosphatidylinositol/phosphatidyl... 72 8e-11 ref|XP_004241238.1| PREDICTED: uncharacterized protein LOC101251... 70 2e-10 >ref|XP_006350757.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X2 [Solanum tuberosum] Length = 457 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +1 Query: 367 MGDSYNPTPGTKSMVTTGITIKNESKQHSISSGSNSFAN 483 MGDS+NPTPGTKSMVTT IT KNESKQH ISSGSNSF N Sbjct: 1 MGDSFNPTPGTKSMVTTAITTKNESKQHIISSGSNSFEN 39 >ref|XP_006350756.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X1 [Solanum tuberosum] Length = 492 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +1 Query: 367 MGDSYNPTPGTKSMVTTGITIKNESKQHSISSGSNSFAN 483 MGDS+NPTPGTKSMVTT IT KNESKQH ISSGSNSF N Sbjct: 1 MGDSFNPTPGTKSMVTTAITTKNESKQHIISSGSNSFEN 39 >ref|XP_004241238.1| PREDICTED: uncharacterized protein LOC101251687 [Solanum lycopersicum] Length = 484 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 367 MGDSYNPTPGTKSMVTTGITIKNESKQHSISSGSNSFAN 483 MGDS+NPTP TKSMVTT IT KNESKQH +SSGSNSFAN Sbjct: 1 MGDSFNPTPRTKSMVTTAITTKNESKQHIVSSGSNSFAN 39