BLASTX nr result
ID: Atropa21_contig00022663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00022663 (478 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231295.1| PREDICTED: putative high mobility group B pr... 61 2e-07 ref|XP_006344849.1| PREDICTED: putative high mobility group B pr... 59 7e-07 >ref|XP_004231295.1| PREDICTED: putative high mobility group B protein 11-like [Solanum lycopersicum] Length = 382 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 95 FNLRQTTVGLHLFYEEVIKRGGFNQVTKDAK 3 FNLRQT + LHLFYEEVIKRGGFNQVTKDAK Sbjct: 75 FNLRQTNLDLHLFYEEVIKRGGFNQVTKDAK 105 >ref|XP_006344849.1| PREDICTED: putative high mobility group B protein 11-like [Solanum tuberosum] Length = 444 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 95 FNLRQTTVGLHLFYEEVIKRGGFNQVTKDA 6 FNLRQT + LHLFYEEVIKRGGFNQVTKDA Sbjct: 75 FNLRQTNLDLHLFYEEVIKRGGFNQVTKDA 104