BLASTX nr result
ID: Atropa21_contig00022351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00022351 (607 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361415.1| PREDICTED: pentatricopeptide repeat-containi... 111 5e-36 ref|XP_004236781.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-35 gb|EMJ06317.1| hypothetical protein PRUPE_ppa004835mg [Prunus pe... 92 2e-27 ref|XP_004304772.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-26 ref|XP_004142590.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-24 ref|XP_006371094.1| hypothetical protein POPTR_0019s03630g [Popu... 84 6e-24 ref|XP_006442665.1| hypothetical protein CICLE_v10019446mg [Citr... 82 1e-23 ref|XP_002521980.1| pentatricopeptide repeat-containing protein,... 82 2e-23 ref|XP_006487702.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-23 gb|EPS74045.1| hypothetical protein M569_00706, partial [Genlise... 79 4e-20 ref|XP_002884468.1| pentatricopeptide repeat-containing protein ... 81 3e-18 ref|XP_006296608.1| hypothetical protein CARUB_v10013258mg [Caps... 80 5e-18 dbj|BAD95034.1| hypothetical protein [Arabidopsis thaliana] 81 5e-18 ref|NP_566237.1| pentatricopeptide repeat-containing protein [Ar... 81 5e-18 ref|XP_003521773.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-17 ref|XP_002266822.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 emb|CAN67401.1| hypothetical protein VITISV_025967 [Vitis vinifera] 92 1e-16 gb|EOY10909.1| Pentatricopeptide repeat (PPR-like) superfamily p... 91 2e-16 gb|EXB93167.1| hypothetical protein L484_024505 [Morus notabilis] 90 4e-16 ref|XP_004494750.1| PREDICTED: pentatricopeptide repeat-containi... 79 4e-16 >ref|XP_006361415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Solanum tuberosum] Length = 583 Score = 111 bits (277), Expect(2) = 5e-36 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 EGNGFPPTVITYNILLLGLCKAHRV +AIEVLAEMVEKGRRPNETTYILLIEGIGF Sbjct: 475 EGNGFPPTVITYNILLLGLCKAHRVVEAIEVLAEMVEKGRRPNETTYILLIEGIGF 530 Score = 66.2 bits (160), Expect(2) = 5e-36 Identities = 36/44 (81%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVY-KDIS 294 FSG RVQAME+ASAIY K AISKESLQRLRK F VPDVY KDI+ Sbjct: 530 FSGRRVQAMEMASAIYHKNAISKESLQRLRKTFQVPDVYNKDIT 573 >ref|XP_004236781.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Solanum lycopersicum] Length = 575 Score = 108 bits (269), Expect(2) = 6e-35 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 EGNGFPPTVITYNILLLGLCKAHRV +AIEVLAEMVEKG RPNETTYILLIEGIGF Sbjct: 470 EGNGFPPTVITYNILLLGLCKAHRVVEAIEVLAEMVEKGCRPNETTYILLIEGIGF 525 Score = 65.9 bits (159), Expect(2) = 6e-35 Identities = 38/51 (74%), Positives = 42/51 (82%), Gaps = 2/51 (3%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVY-KDI-SLSETRK 312 FSG RVQAME+A+AIY K AISKESLQRLRK F VPDVY KDI ++ E RK Sbjct: 525 FSGRRVQAMEMATAIYHKNAISKESLQRLRKTFQVPDVYSKDITTILEIRK 575 >gb|EMJ06317.1| hypothetical protein PRUPE_ppa004835mg [Prunus persica] Length = 489 Score = 91.7 bits (226), Expect(2) = 2e-27 Identities = 45/56 (80%), Positives = 48/56 (85%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 E GF PTVI+YNI+LLGLCK RV DAI+VL EMVEKG RPNETTYILLIEGIGF Sbjct: 386 ETGGFQPTVISYNIILLGLCKTRRVVDAIQVLTEMVEKGCRPNETTYILLIEGIGF 441 Score = 57.0 bits (136), Expect(2) = 2e-27 Identities = 23/48 (47%), Positives = 39/48 (81%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETR 309 F+GWR +AMELA++++ AIS++S +RL + FP+ DV+K+++LSE + Sbjct: 441 FAGWRAEAMELANSVFSLRAISEDSFKRLNRTFPMLDVFKELTLSEIK 488 >ref|XP_004304772.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 586 Score = 88.2 bits (217), Expect(2) = 2e-26 Identities = 44/56 (78%), Positives = 46/56 (82%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 E GF PTVITYNI+LLGL KA R+ DAIEV MVEKG RPNETTYILLIEGIGF Sbjct: 483 EAGGFQPTVITYNIVLLGLSKARRIVDAIEVFTAMVEKGCRPNETTYILLIEGIGF 538 Score = 57.0 bits (136), Expect(2) = 2e-26 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSE 303 F+GWR +AMELA ++Y AI ++S +RL + FP+ DVYK+++LSE Sbjct: 538 FAGWRAEAMELAKSVYSLSAICEDSFKRLSRTFPMLDVYKELTLSE 583 >ref|XP_004142590.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Cucumis sativus] Length = 581 Score = 77.4 bits (189), Expect(2) = 3e-24 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 E F PTVI++NI+LLG+CKAHRV + IE+L MVEKG PNET+Y+LLIEGI + Sbjct: 473 EATRFQPTVISFNIVLLGMCKAHRVFEGIELLITMVEKGCLPNETSYVLLIEGIAY 528 Score = 60.8 bits (146), Expect(2) = 3e-24 Identities = 28/54 (51%), Positives = 42/54 (77%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETRK*LLES 327 ++GWR +AMELA+++Y+ IS +S +RL K FP+ DVYK +SLSE++ LL+S Sbjct: 528 YAGWRAEAMELANSLYRLGVISGDSSKRLNKTFPMLDVYKGLSLSESKNQLLQS 581 >ref|XP_006371094.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa] gi|550316702|gb|ERP48891.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa] Length = 586 Score = 84.3 bits (207), Expect(2) = 6e-24 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +2 Query: 14 FPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 F P +++YNI+LLGLCK HR+DDAIEVL M+E G +PNETTY LLIEGIGF Sbjct: 489 FQPNIVSYNIVLLGLCKVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGF 540 Score = 52.8 bits (125), Expect(2) = 6e-24 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISL 297 FSG R QAMELA+++Y AIS+ S +RL K FP+ DVYKD+++ Sbjct: 540 FSGSRAQAMELANSLYSMNAISEGSYKRLNKVFPLLDVYKDLTV 583 >ref|XP_006442665.1| hypothetical protein CICLE_v10019446mg [Citrus clementina] gi|557544927|gb|ESR55905.1| hypothetical protein CICLE_v10019446mg [Citrus clementina] Length = 583 Score = 81.6 bits (200), Expect(2) = 1e-23 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 E F PTV++YNI++LG CK R+++AIEVLA M EKG +PNETTY+LLIEGIG+ Sbjct: 480 ESTRFRPTVVSYNIIILGFCKTRRINEAIEVLAAMFEKGCKPNETTYVLLIEGIGY 535 Score = 54.3 bits (129), Expect(2) = 1e-23 Identities = 23/48 (47%), Positives = 36/48 (75%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETR 309 + GWR +AMELA+A+ +AIS+++ +RL + FP+ DVYK+IS T+ Sbjct: 535 YGGWRAEAMELANALVSMHAISRDTFKRLNRTFPLLDVYKEISHLATK 582 >ref|XP_002521980.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538784|gb|EEF40384.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 584 Score = 82.0 bits (201), Expect(2) = 2e-23 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = +2 Query: 14 FPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 + P V++YNI+LLGLCK +R +DAIEVLA M EKG +PNETTYILLIEGIGF Sbjct: 484 YRPNVVSYNIILLGLCKVNRANDAIEVLAAMTEKGCQPNETTYILLIEGIGF 535 Score = 53.5 bits (127), Expect(2) = 2e-23 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETRK 312 FSG R +AMELA++++ AIS++S RL K FP+ DVYKD++ S+ K Sbjct: 535 FSGLRAEAMELANSLHGMNAISEDSFNRLNKTFPLLDVYKDLTFSDGSK 583 >ref|XP_006487702.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Citrus sinensis] Length = 583 Score = 80.9 bits (198), Expect(2) = 2e-23 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 E F PTVI+YNI++LG CK R++++IEVLA M EKG +PNETTY+LLIEGIG+ Sbjct: 480 ESTRFRPTVISYNIIILGFCKTRRINESIEVLAAMFEKGCKPNETTYVLLIEGIGY 535 Score = 54.3 bits (129), Expect(2) = 2e-23 Identities = 23/48 (47%), Positives = 36/48 (75%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETR 309 + GWR +AMELA+A+ +AIS+++ +RL + FP+ DVYK+IS T+ Sbjct: 535 YGGWRAEAMELANALVSMHAISRDTFKRLNRTFPLLDVYKEISHLATK 582 >gb|EPS74045.1| hypothetical protein M569_00706, partial [Genlisea aurea] Length = 515 Score = 78.6 bits (192), Expect(2) = 4e-20 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 2/52 (3%) Frame = +2 Query: 20 PTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGR--RPNETTYILLIEGIGF 169 P+V+TYN +LLGLCKAHR+D+A+EVLAEMVE G PNET+++LLIEGIGF Sbjct: 427 PSVVTYNAVLLGLCKAHRMDEAVEVLAEMVEGGGDCEPNETSFVLLIEGIGF 478 Score = 45.4 bits (106), Expect(2) = 4e-20 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDV 279 FSGW V+AME+AS ++Q+ IS SL+RL FP+ DV Sbjct: 478 FSGWPVEAMEIASCLHQRDVISTSSLKRLTVTFPLLDV 515 >ref|XP_002884468.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330308|gb|EFH60727.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 598 Score = 81.3 bits (199), Expect(2) = 3e-18 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +2 Query: 14 FPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 F P+V+TYNI+LLG CKAHR++DAI+VL MV G RPNETTY +LIEGIGF Sbjct: 500 FHPSVVTYNIVLLGFCKAHRIEDAIDVLDSMVGNGCRPNETTYTVLIEGIGF 551 Score = 36.6 bits (83), Expect(2) = 3e-18 Identities = 17/38 (44%), Positives = 28/38 (73%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDV 279 F+G+R +AMELA+ + + AIS+ S +RL + FP+ +V Sbjct: 551 FAGYRAEAMELANDLVRINAISEYSFKRLHRTFPLLNV 588 >ref|XP_006296608.1| hypothetical protein CARUB_v10013258mg [Capsella rubella] gi|482565317|gb|EOA29506.1| hypothetical protein CARUB_v10013258mg [Capsella rubella] Length = 607 Score = 80.1 bits (196), Expect(2) = 5e-18 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = +2 Query: 14 FPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 F P+V+TYNI+LLG CKAHR++DAI+VL MV G RPNE+TY +LIEGIGF Sbjct: 508 FHPSVVTYNIVLLGFCKAHRIEDAIDVLESMVGNGCRPNESTYTVLIEGIGF 559 Score = 37.0 bits (84), Expect(2) = 5e-18 Identities = 17/38 (44%), Positives = 28/38 (73%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDV 279 F+G+R +AMELA+ + + AIS+ S +RL + FP+ +V Sbjct: 559 FAGYRAEAMELANDLVRIDAISEHSFKRLHRTFPLLNV 596 >dbj|BAD95034.1| hypothetical protein [Arabidopsis thaliana] Length = 602 Score = 80.9 bits (198), Expect(2) = 5e-18 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = +2 Query: 14 FPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 F P+V+TYNI+LLG CKAHR++DAI VL MV G RPNETTY +LIEGIGF Sbjct: 504 FHPSVVTYNIVLLGFCKAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGF 555 Score = 36.2 bits (82), Expect(2) = 5e-18 Identities = 17/38 (44%), Positives = 28/38 (73%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDV 279 F+G+R +AMELA+ + + AIS+ S +RL + FP+ +V Sbjct: 555 FAGYRAEAMELANDLVRIDAISEYSFKRLHRTFPLLNV 592 >ref|NP_566237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207286|sp|Q9SR00.1|PP213_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g04760, chloroplastic; Flags: Precursor gi|6175176|gb|AAF04902.1|AC011437_17 hypothetical protein [Arabidopsis thaliana] gi|15810359|gb|AAL07067.1| unknown protein [Arabidopsis thaliana] gi|22136960|gb|AAM91709.1| unknown protein [Arabidopsis thaliana] gi|332640611|gb|AEE74132.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 602 Score = 80.9 bits (198), Expect(2) = 5e-18 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = +2 Query: 14 FPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 F P+V+TYNI+LLG CKAHR++DAI VL MV G RPNETTY +LIEGIGF Sbjct: 504 FHPSVVTYNIVLLGFCKAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGF 555 Score = 36.2 bits (82), Expect(2) = 5e-18 Identities = 17/38 (44%), Positives = 28/38 (73%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDV 279 F+G+R +AMELA+ + + AIS+ S +RL + FP+ +V Sbjct: 555 FAGYRAEAMELANDLVRIDAISEYSFKRLHRTFPLLNV 592 >ref|XP_003521773.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Glycine max] Length = 570 Score = 80.9 bits (198), Expect(2) = 2e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 E + P+V++YNI+LLGLCK RV DAIEVLA MV+KG RPNETTY LIEGIGF Sbjct: 470 ESSECKPSVVSYNIVLLGLCKVSRVSDAIEVLAAMVDKGCRPNETTYTFLIEGIGF 525 Score = 34.3 bits (77), Expect(2) = 2e-17 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSE 303 F G A +LA+ + AIS+ S +RL K F DVY+ ++LS+ Sbjct: 525 FGGCLNDARDLATTLVNMDAISEHSFERLYKTFCKLDVYRQLNLSD 570 >ref|XP_002266822.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Vitis vinifera] Length = 582 Score = 92.0 bits (227), Expect = 1e-16 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 1/98 (1%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGFQDGE 181 E +GF PTVI+YNI+LLGLCK R+DDAI + AEM+EKG RPNETTYILLIEGIGF Sbjct: 479 EQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWR 538 Query: 182 FKRWSWL-VLFIKSMLSRKNHFNV*EKPFPYLMFIKIL 292 + LF + ++S ++ F K FP L K L Sbjct: 539 TEAMELANSLFSRDVIS-QDSFKRLNKTFPMLDVYKEL 575 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/49 (53%), Positives = 40/49 (81%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETRK 312 F+GWR +AMELA++++ + IS++S +RL K FP+ DVYK++S SET+K Sbjct: 534 FAGWRTEAMELANSLFSRDVISQDSFKRLNKTFPMLDVYKELSNSETKK 582 >emb|CAN67401.1| hypothetical protein VITISV_025967 [Vitis vinifera] Length = 592 Score = 92.0 bits (227), Expect = 1e-16 Identities = 53/98 (54%), Positives = 65/98 (66%), Gaps = 1/98 (1%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGFQDGE 181 E +GF PTVI+YNI+LLGLCK R+DDAI + AEM+EKG RPNETTYILLIEGIGF Sbjct: 489 EQSGFRPTVISYNIVLLGLCKVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWR 548 Query: 182 FKRWSWL-VLFIKSMLSRKNHFNV*EKPFPYLMFIKIL 292 + LF + ++S ++ F K FP L K L Sbjct: 549 TEAMELANSLFSRDVIS-QDSFKRLNKTFPMLDVYKEL 585 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/49 (53%), Positives = 40/49 (81%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETRK 312 F+GWR +AMELA++++ + IS++S +RL K FP+ DVYK++S SET+K Sbjct: 544 FAGWRTEAMELANSLFSRDVISQDSFKRLNKTFPMLDVYKELSNSETKK 592 >gb|EOY10909.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 586 Score = 90.9 bits (224), Expect = 2e-16 Identities = 47/89 (52%), Positives = 58/89 (65%) Frame = +2 Query: 8 NGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGFQDGEFK 187 +G PPTVI+YNI+LLGLCK HR++DAIEVLA MV+K +PNETTYILLIEGIGF + Sbjct: 485 SGIPPTVISYNIVLLGLCKVHRINDAIEVLAAMVDKRCQPNETTYILLIEGIGFAGWRSE 544 Query: 188 RWSWLVLFIKSMLSRKNHFNV*EKPFPYL 274 + K+ F + FP L Sbjct: 545 AMELANALFRMEAISKDSFKRLNRTFPLL 573 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/49 (51%), Positives = 39/49 (79%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETRK 312 F+GWR +AMELA+A+++ AISK+S +RL + FP+ DVYK+ + S++ K Sbjct: 538 FAGWRSEAMELANALFRMEAISKDSFKRLNRTFPLLDVYKEFAGSDSNK 586 >gb|EXB93167.1| hypothetical protein L484_024505 [Morus notabilis] Length = 587 Score = 90.1 bits (222), Expect = 4e-16 Identities = 51/97 (52%), Positives = 59/97 (60%) Frame = +2 Query: 2 EGNGFPPTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGFQDGE 181 E GF +VI+YNI+LLGLCKA R+DDAIE+LA MVEKG RPNETTY LLIEGIGF Sbjct: 484 EAGGFKLSVISYNIVLLGLCKARRIDDAIELLAAMVEKGCRPNETTYTLLIEGIGFAGWR 543 Query: 182 FKRWSWLVLFIKSMLSRKNHFNV*EKPFPYLMFIKIL 292 + L ++ F K FP L K L Sbjct: 544 VEAMGLANLLFDIEAISEHSFKRLNKTFPMLDVYKEL 580 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPDVYKDISLSETR 309 F+GWRV+AM LA+ ++ AIS+ S +RL K FP+ DVYK+++LSE + Sbjct: 539 FAGWRVEAMGLANLLFDIEAISEHSFKRLNKTFPMLDVYKELTLSEIK 586 >ref|XP_004494750.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Cicer arietinum] Length = 591 Score = 78.6 bits (192), Expect(2) = 4e-16 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +2 Query: 20 PTVITYNILLLGLCKAHRVDDAIEVLAEMVEKGRRPNETTYILLIEGIGF 169 PTVI++N +LLGLCK R+DDAIEVLA MV++G PNETTY++LIEGIG+ Sbjct: 495 PTVISFNTILLGLCKVRRIDDAIEVLATMVDRGCMPNETTYLVLIEGIGY 544 Score = 32.0 bits (71), Expect(2) = 4e-16 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +1 Query: 166 FSGWRVQAMELASAIYQKYAISKESLQRLRKAFPVPD-VYKDISLS 300 ++GW AMEL S++ AI + + +RL K FP+ + V ++++LS Sbjct: 544 YAGWPNDAMELGSSLVSLGAIHQHTFKRLFKIFPMLNGVNEELTLS 589