BLASTX nr result
ID: Atropa21_contig00021840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00021840 (527 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB35284.1| arabinogalactan-protein [Nicotiana alata] 72 8e-11 ref|XP_006348826.1| PREDICTED: putative uncharacterized protein ... 67 2e-09 >gb|AAB35284.1| arabinogalactan-protein [Nicotiana alata] Length = 461 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 525 YGLYGPHSQEVPSTVKNFDDVETQTPAKEFQGARFNT 415 YGLYGPHSQE+ STV N D+VETQTPAKEFQGARFNT Sbjct: 135 YGLYGPHSQEISSTVTNLDEVETQTPAKEFQGARFNT 171 >ref|XP_006348826.1| PREDICTED: putative uncharacterized protein DDB_G0282133-like [Solanum tuberosum] Length = 392 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 2/39 (5%) Frame = -3 Query: 525 YGLYGPHSQEVPST-VKNFD-DVETQTPAKEFQGARFNT 415 YGLYGPHSQ+VPST + NFD DVETQTPAKEFQGARFNT Sbjct: 124 YGLYGPHSQKVPSTTLTNFDHDVETQTPAKEFQGARFNT 162