BLASTX nr result
ID: Atropa21_contig00021600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00021600 (722 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63809.1| hypothetical protein M569_10976 [Genlisea aurea] 57 6e-06 >gb|EPS63809.1| hypothetical protein M569_10976 [Genlisea aurea] Length = 54 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 267 GLLIVEAYPKRYSSKIPSDLVLFLGLGFID 356 GLL++EAY KRYSSKIPSDLVLFLGLGFID Sbjct: 22 GLLLLEAYNKRYSSKIPSDLVLFLGLGFID 51