BLASTX nr result
ID: Atropa21_contig00021517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00021517 (600 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 65 1e-08 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/43 (76%), Positives = 33/43 (76%) Frame = +3 Query: 333 RFVRDRFTPRGAYTSRLSKFCSKISSENFYREGSISRGAAVLP 461 R VRDRFTPRGAYTSRLSKFCSK S EN YREG AVLP Sbjct: 360 RLVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFPGWLLAVLP 402