BLASTX nr result
ID: Atropa21_contig00021248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00021248 (546 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252782.1| PREDICTED: protein LYK5-like [Solanum lycope... 84 3e-14 ref|XP_006342601.1| PREDICTED: protein LYK5-like [Solanum tubero... 80 2e-13 >ref|XP_004252782.1| PREDICTED: protein LYK5-like [Solanum lycopersicum] Length = 599 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/66 (62%), Positives = 48/66 (72%) Frame = -2 Query: 200 GVSIAISAKNIVEANGFLDEYFLLYPFTTIVIPLPS*PSNLHTGNENHTVTIRSL*PPPA 21 G ++ +NI+EANGFLDE +LYPFTTI+IPLPS PSNL TGNEN+ IRS PP A Sbjct: 194 GKRFKVNGRNIIEANGFLDENSVLYPFTTILIPLPSEPSNLDTGNENYRKPIRSFSPPSA 253 Query: 20 ANV*SG 3 AN G Sbjct: 254 ANASKG 259 >ref|XP_006342601.1| PREDICTED: protein LYK5-like [Solanum tuberosum] Length = 496 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/66 (60%), Positives = 46/66 (69%) Frame = -2 Query: 200 GVSIAISAKNIVEANGFLDEYFLLYPFTTIVIPLPS*PSNLHTGNENHTVTIRSL*PPPA 21 G +S NIVE+NGFLDE +LYPFTTI+IPLPS PSNL T NEN+ +RS PPP Sbjct: 81 GKRFNVSVTNIVESNGFLDENSVLYPFTTILIPLPSEPSNLDTRNENYRKPVRSFSPPPV 140 Query: 20 ANV*SG 3 AN G Sbjct: 141 ANASKG 146