BLASTX nr result
ID: Atropa21_contig00020893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00020893 (533 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358285.1| PREDICTED: blue copper protein-like [Solanum... 59 5e-07 >ref|XP_006358285.1| PREDICTED: blue copper protein-like [Solanum tuberosum] Length = 237 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 279 DGLIPPPAPSSATRNVFTSAFVMFMSIAISIMW 377 DGL+PPPAPSSA+R+VF A +MFMSIAISIMW Sbjct: 205 DGLVPPPAPSSASRSVFAPALIMFMSIAISIMW 237