BLASTX nr result
ID: Atropa21_contig00019779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00019779 (450 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343896.1| PREDICTED: putative glucose-6-phosphate 1-ep... 86 7e-15 ref|XP_004245545.1| PREDICTED: putative glucose-6-phosphate 1-ep... 86 7e-15 ref|XP_002280220.1| PREDICTED: putative glucose-6-phosphate 1-ep... 83 4e-14 ref|XP_006476439.1| PREDICTED: putative glucose-6-phosphate 1-ep... 82 6e-14 ref|XP_006439413.1| hypothetical protein CICLE_v10021324mg [Citr... 82 6e-14 ref|XP_004511533.1| PREDICTED: putative glucose-6-phosphate 1-ep... 82 7e-14 emb|CAN81195.1| hypothetical protein VITISV_022854 [Vitis vinifera] 82 7e-14 ref|XP_002509914.1| aldose 1-epimerase, putative [Ricinus commun... 80 2e-13 gb|EOX95795.1| Galactose mutarotase-like superfamily protein [Th... 80 3e-13 ref|XP_004298869.1| PREDICTED: putative glucose-6-phosphate 1-ep... 80 3e-13 ref|XP_004298868.1| PREDICTED: putative glucose-6-phosphate 1-ep... 80 3e-13 ref|XP_006339669.1| PREDICTED: putative glucose-6-phosphate 1-ep... 79 5e-13 ref|XP_004229975.1| PREDICTED: putative glucose-6-phosphate 1-ep... 79 5e-13 ref|XP_004305459.1| PREDICTED: putative glucose-6-phosphate 1-ep... 79 6e-13 ref|XP_002511956.1| aldose 1-epimerase, putative [Ricinus commun... 79 6e-13 ref|XP_002299496.1| hypothetical protein POPTR_0001s10270g [Popu... 79 6e-13 gb|ESW07839.1| hypothetical protein PHAVU_010G163100g [Phaseolus... 79 8e-13 gb|EOY24924.1| Galactose mutarotase-like superfamily protein [Th... 79 8e-13 ref|XP_006597781.1| PREDICTED: putative glucose-6-phosphate 1-ep... 78 1e-12 ref|XP_006586986.1| PREDICTED: putative glucose-6-phosphate 1-ep... 78 1e-12 >ref|XP_006343896.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Solanum tuberosum] Length = 303 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL Sbjct: 180 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 220 >ref|XP_004245545.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Solanum lycopersicum] Length = 303 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL Sbjct: 180 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 220 >ref|XP_002280220.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Vitis vinifera] gi|297745389|emb|CBI40469.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 82.8 bits (203), Expect = 4e-14 Identities = 44/70 (62%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = +2 Query: 242 TCFNERMNFMAYPYSL-FIQNLKTNRSYDSEVRVEGLETLDYLDNLCNRERFTEQGDALT 418 T + N P+S F + + S SEVR+EGLETLDYLDNLC RERFTEQGDA+T Sbjct: 152 TLISRIRNINGRPFSFSFAYHTYLSVSDISEVRIEGLETLDYLDNLCQRERFTEQGDAIT 211 Query: 419 FESEVDRVYL 448 FESEVDRVYL Sbjct: 212 FESEVDRVYL 221 >ref|XP_006476439.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Citrus sinensis] Length = 304 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVR+EGLETLDYLDNLC RERFTEQGDALTFESE+DRVYL Sbjct: 181 SEVRIEGLETLDYLDNLCQRERFTEQGDALTFESEIDRVYL 221 >ref|XP_006439413.1| hypothetical protein CICLE_v10021324mg [Citrus clementina] gi|557541675|gb|ESR52653.1| hypothetical protein CICLE_v10021324mg [Citrus clementina] Length = 304 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVR+EGLETLDYLDNLC RERFTEQGDALTFESE+DRVYL Sbjct: 181 SEVRIEGLETLDYLDNLCQRERFTEQGDALTFESEIDRVYL 221 >ref|XP_004511533.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Cicer arietinum] Length = 304 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNLC +ERFTEQGDALTFESEVDRVYL Sbjct: 181 SEVRVEGLETLDYLDNLCQKERFTEQGDALTFESEVDRVYL 221 >emb|CAN81195.1| hypothetical protein VITISV_022854 [Vitis vinifera] Length = 364 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVR+EGLETLDYLDNLC RERFTEQGDA+TFESEVDRVYL Sbjct: 233 SEVRIEGLETLDYLDNLCQRERFTEQGDAITFESEVDRVYL 273 >ref|XP_002509914.1| aldose 1-epimerase, putative [Ricinus communis] gi|223549813|gb|EEF51301.1| aldose 1-epimerase, putative [Ricinus communis] Length = 305 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNLC +ERFTEQGD LTFESEVDRVYL Sbjct: 182 SEVRVEGLETLDYLDNLCQKERFTEQGDTLTFESEVDRVYL 222 >gb|EOX95795.1| Galactose mutarotase-like superfamily protein [Theobroma cacao] Length = 317 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVR+EGLETLDYLDN+C +ERFTEQGDA+TFESEVDRVYL Sbjct: 181 SEVRIEGLETLDYLDNICQKERFTEQGDAITFESEVDRVYL 221 >ref|XP_004298869.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 2 [Fragaria vesca subsp. vesca] Length = 298 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVR+EGLETLDYLDNLC +ERFTEQGDALTFESEVDR YL Sbjct: 175 SEVRIEGLETLDYLDNLCEKERFTEQGDALTFESEVDRAYL 215 >ref|XP_004298868.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 1 [Fragaria vesca subsp. vesca] Length = 299 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVR+EGLETLDYLDNLC +ERFTEQGDALTFESEVDR YL Sbjct: 176 SEVRIEGLETLDYLDNLCEKERFTEQGDALTFESEVDRAYL 216 >ref|XP_006339669.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Solanum tuberosum] Length = 308 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SE+R+EGLETLDYLDNLC +ERFTEQGDA+TFESE+DRVYL Sbjct: 181 SEIRIEGLETLDYLDNLCQKERFTEQGDAITFESEMDRVYL 221 >ref|XP_004229975.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 1 [Solanum lycopersicum] gi|460368241|ref|XP_004229976.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 2 [Solanum lycopersicum] Length = 308 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SE+R+EGLETLDYLDNLC +ERFTEQGDA+TFESE+DRVYL Sbjct: 181 SEIRIEGLETLDYLDNLCQKERFTEQGDAITFESEMDRVYL 221 >ref|XP_004305459.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Fragaria vesca subsp. vesca] Length = 326 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNL NRERFTEQGDA+TFESEVD+VYL Sbjct: 185 SEVRVEGLETLDYLDNLKNRERFTEQGDAITFESEVDKVYL 225 >ref|XP_002511956.1| aldose 1-epimerase, putative [Ricinus communis] gi|223549136|gb|EEF50625.1| aldose 1-epimerase, putative [Ricinus communis] Length = 317 Score = 79.0 bits (193), Expect = 6e-13 Identities = 43/63 (68%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = +2 Query: 263 NFMAYPYSL-FIQNLKTNRSYDSEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDR 439 N P+S F + + S SEVR+EGLETLDYLDNL RERFTEQGDALTFESEVDR Sbjct: 159 NINGKPFSFSFAYHTYLSVSDISEVRIEGLETLDYLDNLYQRERFTEQGDALTFESEVDR 218 Query: 440 VYL 448 VYL Sbjct: 219 VYL 221 >ref|XP_002299496.1| hypothetical protein POPTR_0001s10270g [Populus trichocarpa] gi|222846754|gb|EEE84301.1| hypothetical protein POPTR_0001s10270g [Populus trichocarpa] Length = 306 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNL RERFTEQGDALTFESEVDRVYL Sbjct: 183 SEVRVEGLETLDYLDNLFQRERFTEQGDALTFESEVDRVYL 223 >gb|ESW07839.1| hypothetical protein PHAVU_010G163100g [Phaseolus vulgaris] Length = 314 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVR+EGLETLDYLDNL NRERFTEQGDA+TFESEVD+VYL Sbjct: 176 SEVRIEGLETLDYLDNLKNRERFTEQGDAITFESEVDKVYL 216 >gb|EOY24924.1| Galactose mutarotase-like superfamily protein [Theobroma cacao] Length = 304 Score = 78.6 bits (192), Expect = 8e-13 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNL RERFTEQGDALTFESEVDRVYL Sbjct: 181 SEVRVEGLETLDYLDNLRQRERFTEQGDALTFESEVDRVYL 221 >ref|XP_006597781.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X2 [Glycine max] Length = 287 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNL N+ERFTEQGDALTFESEVD++YL Sbjct: 149 SEVRVEGLETLDYLDNLQNKERFTEQGDALTFESEVDKIYL 189 >ref|XP_006586986.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform X3 [Glycine max] Length = 260 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 326 SEVRVEGLETLDYLDNLCNRERFTEQGDALTFESEVDRVYL 448 SEVRVEGLETLDYLDNL N+ERFTEQGDALTFESEVD++YL Sbjct: 122 SEVRVEGLETLDYLDNLQNKERFTEQGDALTFESEVDKIYL 162