BLASTX nr result
ID: Atropa21_contig00019319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00019319 (528 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247198.1| PREDICTED: protein TIFY 4B-like [Solanum lyc... 67 3e-09 ref|XP_006349716.1| PREDICTED: protein TIFY 4B-like isoform X1 [... 65 1e-08 >ref|XP_004247198.1| PREDICTED: protein TIFY 4B-like [Solanum lycopersicum] Length = 339 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 528 PPTIRLSAAPAPSGSMDNILQMNANTSAFLNEKDGKE 418 PP IRLSAAPAPSGSMDNILQM+AN S FL++KDGKE Sbjct: 303 PPAIRLSAAPAPSGSMDNILQMDANASGFLDDKDGKE 339 >ref|XP_006349716.1| PREDICTED: protein TIFY 4B-like isoform X1 [Solanum tuberosum] Length = 339 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 528 PPTIRLSAAPAPSGSMDNILQMNANTSAFLNEKDGKE 418 PP IRLS APAPSGSMDNILQM+AN S FL++KDGKE Sbjct: 303 PPAIRLSVAPAPSGSMDNILQMDANASGFLDDKDGKE 339