BLASTX nr result
ID: Atropa21_contig00019318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00019318 (1504 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349342.1| PREDICTED: ATP-dependent RNA helicase Dhx29-... 63 4e-07 ref|XP_004231331.1| PREDICTED: ATP-dependent RNA helicase Dhx29-... 63 4e-07 >ref|XP_006349342.1| PREDICTED: ATP-dependent RNA helicase Dhx29-like [Solanum tuberosum] Length = 1438 Score = 62.8 bits (151), Expect = 4e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -2 Query: 339 FIML*FQVETNKVFL*DTTVVSPYTILLFGGPINVQHHVSFV 214 F++ +VETNKVFL DTTVVSPYTILLFGGPINVQH V Sbjct: 1335 FLVFLEKVETNKVFLRDTTVVSPYTILLFGGPINVQHQTGTV 1376 >ref|XP_004231331.1| PREDICTED: ATP-dependent RNA helicase Dhx29-like [Solanum lycopersicum] Length = 1453 Score = 62.8 bits (151), Expect = 4e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -2 Query: 339 FIML*FQVETNKVFL*DTTVVSPYTILLFGGPINVQHHVSFV 214 F++ +VETNKVFL DTTVVSPYTILLFGGPINVQH V Sbjct: 1350 FLVFLEKVETNKVFLRDTTVVSPYTILLFGGPINVQHQTGTV 1391