BLASTX nr result
ID: Atropa21_contig00019277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00019277 (470 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61919.1| hypothetical protein M569_12874 [Genlisea aurea] 56 4e-06 >gb|EPS61919.1| hypothetical protein M569_12874 [Genlisea aurea] Length = 1149 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/71 (42%), Positives = 40/71 (56%) Frame = -1 Query: 404 KKSFVGSRERICVPTKWKVFLCILNMGILHFSWPANQISLVTQDPALLPSILLENNLYGM 225 K + V ER P + ++ L +N+ L W NQI LV Q+PAL + +LEN LYG Sbjct: 298 KSTVVSLIERFYDPNQGEILLDDVNIKTLQLRWLRNQIGLVNQEPALFATTILENILYGK 357 Query: 224 PDAAMVEFAAS 192 PDA M E A+ Sbjct: 358 PDATMEEVEAA 368