BLASTX nr result
ID: Atropa21_contig00018169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00018169 (1334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004249350.1| PREDICTED: protein GrpE-like [Solanum lycope... 69 2e-11 ref|XP_006339226.1| PREDICTED: grpE protein homolog, mitochondri... 69 3e-11 >ref|XP_004249350.1| PREDICTED: protein GrpE-like [Solanum lycopersicum] Length = 352 Score = 68.6 bits (166), Expect(2) = 2e-11 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = +2 Query: 38 TPLLPIRCRIHHSGNPIVQLTHRSVEKFVIFASNEDATELA 160 TPLLP RCRIHHS N IV L HRSVEKFVIFASNED E A Sbjct: 46 TPLLPRRCRIHHSANSIVPLQHRSVEKFVIFASNEDVAEAA 86 Score = 28.5 bits (62), Expect(2) = 2e-11 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +3 Query: 3 TFLSYSRCGRKQ 38 TFLSYSRCGR+Q Sbjct: 34 TFLSYSRCGRRQ 45 >ref|XP_006339226.1| PREDICTED: grpE protein homolog, mitochondrial-like [Solanum tuberosum] Length = 357 Score = 69.3 bits (168), Expect(2) = 3e-11 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = +2 Query: 38 TPLLPIRCRIHHSGNPIVQLTHRSVEKFVIFASNEDATELA 160 TPLLP RCRIHHS N IVQ HRSVEKFVIFASNED E A Sbjct: 46 TPLLPRRCRIHHSANSIVQFQHRSVEKFVIFASNEDVAEAA 86 Score = 26.9 bits (58), Expect(2) = 3e-11 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +3 Query: 3 TFLSYSRCGRKQ 38 TFLSYSRCG++Q Sbjct: 34 TFLSYSRCGQRQ 45