BLASTX nr result
ID: Atropa21_contig00017102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00017102 (634 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252083.1| PREDICTED: early nodulin-like protein 1-like... 63 8e-08 >ref|XP_004252083.1| PREDICTED: early nodulin-like protein 1-like [Solanum lycopersicum] Length = 279 Score = 62.8 bits (151), Expect = 8e-08 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 2/61 (3%) Frame = -1 Query: 430 WVENHEVSCSNPSRDKKILGDFVPSQP*WTE--LLVGDGRYLVELVKVCASWPGHHGYKK 257 WVE+++ S + +ILG F PS + LLVG GRYLV+LVKV SWPGHHGY K Sbjct: 171 WVESNKRSQVQIPTETRILGGFFPSDLALVDYLLLVGGGRYLVKLVKVHTSWPGHHGYSK 230 Query: 256 K 254 K Sbjct: 231 K 231