BLASTX nr result
ID: Atropa21_contig00016117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00016117 (477 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355310.1| PREDICTED: clathrin interactor EPSIN 1-like ... 80 3e-13 ref|XP_006355309.1| PREDICTED: clathrin interactor EPSIN 1-like ... 80 3e-13 ref|XP_004245127.1| PREDICTED: clathrin interactor EPSIN 1-like ... 78 1e-12 >ref|XP_006355310.1| PREDICTED: clathrin interactor EPSIN 1-like isoform X2 [Solanum tuberosum] Length = 551 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 1 FYTSRAMDQGIGHGKSGFPSAARAGNDIFSSLDTQNYQFGSFQK 132 FY+S+AM QGIG+GKSGFPSAA AG+DIFSSL+TQNYQFGSFQK Sbjct: 508 FYSSKAMGQGIGYGKSGFPSAATAGDDIFSSLNTQNYQFGSFQK 551 >ref|XP_006355309.1| PREDICTED: clathrin interactor EPSIN 1-like isoform X1 [Solanum tuberosum] Length = 552 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 1 FYTSRAMDQGIGHGKSGFPSAARAGNDIFSSLDTQNYQFGSFQK 132 FY+S+AM QGIG+GKSGFPSAA AG+DIFSSL+TQNYQFGSFQK Sbjct: 509 FYSSKAMGQGIGYGKSGFPSAATAGDDIFSSLNTQNYQFGSFQK 552 >ref|XP_004245127.1| PREDICTED: clathrin interactor EPSIN 1-like [Solanum lycopersicum] Length = 553 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +1 Query: 1 FYTSRAMDQGIGHGKSGFPSAARAGNDIFSSLDTQNYQFGSFQK 132 FY+S+AM QGIG+GKSGFPSA AG+DIFSSL+TQNYQFGSFQK Sbjct: 510 FYSSKAMGQGIGYGKSGFPSAPTAGDDIFSSLNTQNYQFGSFQK 553