BLASTX nr result
ID: Atropa21_contig00015202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00015202 (693 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ02501.1| hypothetical protein PRUPE_ppa009911mg [Prunus pe... 76 1e-11 ref|XP_004230929.1| PREDICTED: putative ER lumen protein retaini... 75 2e-11 ref|XP_002529256.1| ER lumen protein retaining receptor, putativ... 75 2e-11 gb|ABK22143.1| unknown [Picea sitchensis] 75 3e-11 gb|EOX97774.1| ER lumen protein retaining receptor family protei... 74 3e-11 gb|EOX97773.1| ER lumen protein retaining receptor family protei... 74 3e-11 ref|XP_004505682.1| PREDICTED: putative ER lumen protein retaini... 74 3e-11 gb|AFK45543.1| unknown [Lotus japonicus] 74 3e-11 ref|XP_006367336.1| PREDICTED: putative ER lumen protein retaini... 74 4e-11 gb|ESW07880.1| hypothetical protein PHAVU_009G000500g [Phaseolus... 74 4e-11 ref|XP_004248675.1| PREDICTED: ER lumen protein retaining recept... 74 4e-11 gb|EXB36842.1| ER lumen protein retaining receptor [Morus notabi... 74 6e-11 ref|XP_003523489.2| PREDICTED: putative ER lumen protein retaini... 74 6e-11 ref|XP_006423583.1| hypothetical protein CICLE_v10029042mg [Citr... 74 6e-11 ref|XP_006423582.1| hypothetical protein CICLE_v10029042mg [Citr... 74 6e-11 ref|XP_006581164.1| PREDICTED: putative ER lumen protein retaini... 74 6e-11 ref|XP_003522766.1| PREDICTED: putative ER lumen protein retaini... 74 6e-11 gb|ACU20908.1| unknown [Glycine max] 74 6e-11 ref|XP_006284310.1| hypothetical protein CARUB_v10005480mg [Caps... 73 7e-11 ref|XP_002312984.1| ER lumen protein retaining receptor [Populus... 73 7e-11 >gb|EMJ02501.1| hypothetical protein PRUPE_ppa009911mg [Prunus persica] Length = 272 Score = 75.9 bits (185), Expect = 1e-11 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 67 LTKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 110 >ref|XP_004230929.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like [Solanum lycopersicum] gi|565387738|ref|XP_006359645.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like [Solanum tuberosum] Length = 272 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 74 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 110 >ref|XP_002529256.1| ER lumen protein retaining receptor, putative [Ricinus communis] gi|223531292|gb|EEF33134.1| ER lumen protein retaining receptor, putative [Ricinus communis] Length = 272 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 74 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 110 >gb|ABK22143.1| unknown [Picea sitchensis] Length = 275 Score = 74.7 bits (182), Expect = 3e-11 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 70 LTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEYDIHTLLDLAT 113 >gb|EOX97774.1| ER lumen protein retaining receptor family protein isoform 2 [Theobroma cacao] Length = 271 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 67 LTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLAT 110 >gb|EOX97773.1| ER lumen protein retaining receptor family protein isoform 1 [Theobroma cacao] Length = 272 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 67 LTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLAT 110 >ref|XP_004505682.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like [Cicer arietinum] Length = 272 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHT+LDLAT Sbjct: 74 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTILDLAT 110 >gb|AFK45543.1| unknown [Lotus japonicus] Length = 272 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/50 (78%), Positives = 40/50 (80%) Frame = -2 Query: 152 SCSFF*LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 S F LT AGLSLKSQELTAMFLAVRLYCSFVMEYDIHT+LD AT Sbjct: 61 SLLIFKLTKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTILDTAT 110 >ref|XP_006367336.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like [Solanum tuberosum] Length = 272 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AG+SLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 67 LTKEKTCAGISLKSQELTALFLAVRLYCSFVMEYDIHTLLDLAT 110 >gb|ESW07880.1| hypothetical protein PHAVU_009G000500g [Phaseolus vulgaris] Length = 272 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 74 AGLSLKSQELTALFLAVRLYCSFVMEYDIHTLLDLAT 110 >ref|XP_004248675.1| PREDICTED: ER lumen protein retaining receptor-like [Solanum lycopersicum] Length = 272 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AG+SLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 67 LTKEKTCAGISLKSQELTALFLAVRLYCSFVMEYDIHTLLDLAT 110 >gb|EXB36842.1| ER lumen protein retaining receptor [Morus notabilis] Length = 225 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 74 AGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLAT 110 >ref|XP_003523489.2| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like [Glycine max] Length = 322 Score = 73.6 bits (179), Expect = 6e-11 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AGLSLKSQELTAMFL VRLYCSFVMEYDIHTLLD+AT Sbjct: 117 LTKEKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMAT 160 >ref|XP_006423583.1| hypothetical protein CICLE_v10029042mg [Citrus clementina] gi|557525517|gb|ESR36823.1| hypothetical protein CICLE_v10029042mg [Citrus clementina] Length = 227 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 74 AGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLAT 110 >ref|XP_006423582.1| hypothetical protein CICLE_v10029042mg [Citrus clementina] gi|568868190|ref|XP_006487397.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like [Citrus sinensis] gi|557525516|gb|ESR36822.1| hypothetical protein CICLE_v10029042mg [Citrus clementina] Length = 272 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 74 AGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLAT 110 >ref|XP_006581164.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4 [Glycine max] Length = 272 Score = 73.6 bits (179), Expect = 6e-11 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AGLSLKSQELTAMFL VRLYCSFVMEYDIHTLLD+AT Sbjct: 67 LTREKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMAT 110 >ref|XP_003522766.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like [Glycine max] Length = 272 Score = 73.6 bits (179), Expect = 6e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTA+FLAVRLYCSFVMEYDIHTLLDLAT Sbjct: 74 AGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLAT 110 >gb|ACU20908.1| unknown [Glycine max] Length = 265 Score = 73.6 bits (179), Expect = 6e-11 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -2 Query: 134 LTMMYIIAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 LT AGLSLKSQELTAMFL VRLYCSFVMEYDIHTLLD+AT Sbjct: 67 LTREKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMAT 110 >ref|XP_006284310.1| hypothetical protein CARUB_v10005480mg [Capsella rubella] gi|482553015|gb|EOA17208.1| hypothetical protein CARUB_v10005480mg [Capsella rubella] Length = 273 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLKSQELTA+FLAVRLYCSFVMEYDIHT+LDLAT Sbjct: 75 AGLSLKSQELTALFLAVRLYCSFVMEYDIHTILDLAT 111 >ref|XP_002312984.1| ER lumen protein retaining receptor [Populus trichocarpa] gi|222849392|gb|EEE86939.1| ER lumen protein retaining receptor [Populus trichocarpa] Length = 272 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 113 AGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLAT 3 AGLSLK+QELTAMFLAVRLYCSFVMEYDIHT+LDLAT Sbjct: 74 AGLSLKTQELTAMFLAVRLYCSFVMEYDIHTILDLAT 110