BLASTX nr result
ID: Atropa21_contig00014626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00014626 (950 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006365031.1| PREDICTED: ABC transporter I family member 1... 60 2e-06 ref|XP_006365030.1| PREDICTED: ABC transporter I family member 1... 60 2e-06 ref|XP_006365029.1| PREDICTED: ABC transporter I family member 1... 60 2e-06 ref|XP_006365027.1| PREDICTED: ABC transporter I family member 1... 60 2e-06 ref|XP_004233288.1| PREDICTED: ABC transporter I family member 1... 60 2e-06 >ref|XP_006365031.1| PREDICTED: ABC transporter I family member 11, chloroplastic-like isoform X5 [Solanum tuberosum] Length = 223 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 853 CFYG-FEIRDVSYRPPGTKIDLLSQVNLSIPEK 948 C Y FEIRDVSYRPPGTKIDLLSQVNLSIPEK Sbjct: 44 CDYSCFEIRDVSYRPPGTKIDLLSQVNLSIPEK 76 >ref|XP_006365030.1| PREDICTED: ABC transporter I family member 11, chloroplastic-like isoform X4 [Solanum tuberosum] Length = 259 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 853 CFYG-FEIRDVSYRPPGTKIDLLSQVNLSIPEK 948 C Y FEIRDVSYRPPGTKIDLLSQVNLSIPEK Sbjct: 44 CDYSCFEIRDVSYRPPGTKIDLLSQVNLSIPEK 76 >ref|XP_006365029.1| PREDICTED: ABC transporter I family member 11, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 276 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 853 CFYG-FEIRDVSYRPPGTKIDLLSQVNLSIPEK 948 C Y FEIRDVSYRPPGTKIDLLSQVNLSIPEK Sbjct: 44 CDYSCFEIRDVSYRPPGTKIDLLSQVNLSIPEK 76 >ref|XP_006365027.1| PREDICTED: ABC transporter I family member 11, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565398953|ref|XP_006365028.1| PREDICTED: ABC transporter I family member 11, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 312 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 853 CFYG-FEIRDVSYRPPGTKIDLLSQVNLSIPEK 948 C Y FEIRDVSYRPPGTKIDLLSQVNLSIPEK Sbjct: 44 CDYSCFEIRDVSYRPPGTKIDLLSQVNLSIPEK 76 >ref|XP_004233288.1| PREDICTED: ABC transporter I family member 11, chloroplastic-like [Solanum lycopersicum] Length = 274 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 853 CFYG-FEIRDVSYRPPGTKIDLLSQVNLSIPEK 948 C Y FEIRDVSYRPPGTKIDLLSQVNLSIPEK Sbjct: 42 CDYSCFEIRDVSYRPPGTKIDLLSQVNLSIPEK 74