BLASTX nr result
ID: Atropa21_contig00013290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00013290 (517 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358285.1| PREDICTED: blue copper protein-like [Solanum... 63 3e-08 >ref|XP_006358285.1| PREDICTED: blue copper protein-like [Solanum tuberosum] Length = 237 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 252 SDGLIPPPAPSSATRSFFASALVMFMSIAISIMW 353 SDGL+PPPAPSSA+RS FA AL+MFMSIAISIMW Sbjct: 204 SDGLVPPPAPSSASRSVFAPALIMFMSIAISIMW 237