BLASTX nr result
ID: Atropa21_contig00013058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00013058 (525 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346233.1| PREDICTED: uncharacterized protein At4g15545... 65 3e-13 ref|XP_004243975.1| PREDICTED: uncharacterized protein LOC101255... 60 2e-12 >ref|XP_006346233.1| PREDICTED: uncharacterized protein At4g15545-like [Solanum tuberosum] Length = 342 Score = 65.5 bits (158), Expect(2) = 3e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 441 KITSASVSPRRYSAAVSPQRTSGSNSPTIPQFQRRV 334 KITSASVSPRR SAAVSP+RTSGS SPTIPQFQRRV Sbjct: 210 KITSASVSPRRCSAAVSPRRTSGSTSPTIPQFQRRV 245 Score = 34.7 bits (78), Expect(2) = 3e-13 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 523 RGSHGDAPKQALQRFSSPYI 464 RGS+GDA +LQRFSSPYI Sbjct: 180 RGSNGDASNHSLQRFSSPYI 199 >ref|XP_004243975.1| PREDICTED: uncharacterized protein LOC101255902 [Solanum lycopersicum] Length = 361 Score = 59.7 bits (143), Expect(2) = 2e-12 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 441 KITSASVSPRRYSAAVSPQRTSGSNSPTIPQFQRR 337 KI SASVSPRR SAAVSP+R SGS SPTIPQFQRR Sbjct: 210 KIASASVSPRRCSAAVSPRRISGSTSPTIPQFQRR 244 Score = 37.7 bits (86), Expect(2) = 2e-12 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 523 RGSHGDAPKQALQRFSSPYI 464 RGS+GDA K ALQRFSSPYI Sbjct: 180 RGSNGDASKHALQRFSSPYI 199