BLASTX nr result
ID: Atropa21_contig00012480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00012480 (1290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361109.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 65 5e-08 ref|XP_004241355.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 65 8e-08 ref|XP_003596922.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 62 5e-07 ref|XP_004291525.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 2e-06 ref|XP_003543403.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 2e-06 ref|XP_004487441.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 2e-06 ref|XP_004487440.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 2e-06 dbj|BAK05281.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 3e-06 gb|EXB39662.1| Ubiquitin carboxyl-terminal hydrolase 8 [Morus no... 58 1e-05 ref|XP_006664758.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 1e-05 gb|ESW21997.1| hypothetical protein PHAVU_005G117700g [Phaseolus... 58 1e-05 gb|EPS63126.1| ubiquitin carboxyl-terminal hydrolase, partial [G... 58 1e-05 ref|XP_004963176.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 1e-05 tpg|DAA54733.1| TPA: hypothetical protein ZEAMMB73_341521 [Zea m... 58 1e-05 ref|XP_002442564.1| hypothetical protein SORBIDRAFT_08g022020 [S... 58 1e-05 >ref|XP_006361109.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Solanum tuberosum] Length = 875 Score = 65.5 bits (158), Expect = 5e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 DDRPDEEIADEYW+YHLARNDSIIVDVCQ Sbjct: 399 DDRPDEEIADEYWNYHLARNDSIIVDVCQ 427 >ref|XP_004241355.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Solanum lycopersicum] Length = 875 Score = 64.7 bits (156), Expect = 8e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 DDRPDEEIADEYW YHLARNDSIIVDVCQ Sbjct: 399 DDRPDEEIADEYWHYHLARNDSIIVDVCQ 427 >ref|XP_003596922.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355485970|gb|AES67173.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 871 Score = 62.0 bits (149), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW+YHLARNDS+IVDVCQ Sbjct: 392 DGRPDEEVADEYWNYHLARNDSVIVDVCQ 420 >ref|XP_004291525.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Fragaria vesca subsp. vesca] Length = 885 Score = 60.5 bits (145), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 DDRPDEE+ADEYW HLARNDSIIVDVCQ Sbjct: 408 DDRPDEEVADEYWRNHLARNDSIIVDVCQ 436 >ref|XP_003543403.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Glycine max] Length = 872 Score = 60.5 bits (145), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 DDRPDEE+ADEYW HLARNDS+IVDVCQ Sbjct: 399 DDRPDEEVADEYWHNHLARNDSVIVDVCQ 427 >ref|XP_004487441.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X2 [Cicer arietinum] Length = 873 Score = 60.1 bits (144), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW YHLARNDS+IVD+CQ Sbjct: 395 DGRPDEEVADEYWHYHLARNDSVIVDLCQ 423 >ref|XP_004487440.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X1 [Cicer arietinum] Length = 870 Score = 60.1 bits (144), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW YHLARNDS+IVD+CQ Sbjct: 395 DGRPDEEVADEYWHYHLARNDSVIVDLCQ 423 >dbj|BAK05281.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 127 Score = 59.7 bits (143), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQLSNTRL 105 D RPDEE+ADEYW HLARNDSIIVD CQ+S R+ Sbjct: 76 DGRPDEEVADEYWGNHLARNDSIIVDTCQVSFMRI 110 >gb|EXB39662.1| Ubiquitin carboxyl-terminal hydrolase 8 [Morus notabilis] Length = 833 Score = 57.8 bits (138), Expect = 1e-05 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW HLARNDSIIVDVCQ Sbjct: 354 DGRPDEEVADEYWRNHLARNDSIIVDVCQ 382 >ref|XP_006664758.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Oryza brachyantha] Length = 862 Score = 57.8 bits (138), Expect = 1e-05 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW HLARNDSIIVD+CQ Sbjct: 367 DGRPDEEVADEYWGNHLARNDSIIVDICQ 395 >gb|ESW21997.1| hypothetical protein PHAVU_005G117700g [Phaseolus vulgaris] Length = 872 Score = 57.8 bits (138), Expect = 1e-05 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW HLARNDS+IVDVCQ Sbjct: 399 DGRPDEEVADEYWHNHLARNDSVIVDVCQ 427 >gb|EPS63126.1| ubiquitin carboxyl-terminal hydrolase, partial [Genlisea aurea] Length = 790 Score = 57.8 bits (138), Expect = 1e-05 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW HLARNDSIIVDVCQ Sbjct: 371 DGRPDEEVADEYWRNHLARNDSIIVDVCQ 399 >ref|XP_004963176.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Setaria italica] Length = 912 Score = 57.8 bits (138), Expect = 1e-05 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW HLARNDSIIVD+CQ Sbjct: 419 DGRPDEEVADEYWGNHLARNDSIIVDICQ 447 >tpg|DAA54733.1| TPA: hypothetical protein ZEAMMB73_341521 [Zea mays] Length = 888 Score = 57.8 bits (138), Expect = 1e-05 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW HLARNDSIIVD+CQ Sbjct: 395 DGRPDEEVADEYWGNHLARNDSIIVDICQ 423 >ref|XP_002442564.1| hypothetical protein SORBIDRAFT_08g022020 [Sorghum bicolor] gi|241943257|gb|EES16402.1| hypothetical protein SORBIDRAFT_08g022020 [Sorghum bicolor] Length = 890 Score = 57.8 bits (138), Expect = 1e-05 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 1 DDRPDEEIADEYWDYHLARNDSIIVDVCQ 87 D RPDEE+ADEYW HLARNDSIIVD+CQ Sbjct: 397 DGRPDEEVADEYWGNHLARNDSIIVDICQ 425