BLASTX nr result
ID: Atropa21_contig00010881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00010881 (1001 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339700.1| PREDICTED: F-box protein At5g51380-like isof... 65 4e-08 >ref|XP_006339700.1| PREDICTED: F-box protein At5g51380-like isoform X1 [Solanum tuberosum] Length = 499 Score = 65.1 bits (157), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 999 KWRPDSRSFLSSGLEGTGIGQKGGRSLRRK 910 KWRPDSRSFLSSGLEGTGIGQKGGRSLRRK Sbjct: 470 KWRPDSRSFLSSGLEGTGIGQKGGRSLRRK 499