BLASTX nr result
ID: Atropa21_contig00010508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00010508 (552 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004236666.1| PREDICTED: U-box domain-containing protein 4... 96 7e-18 ref|XP_004250274.1| PREDICTED: U-box domain-containing protein 4... 92 8e-17 ref|XP_006346779.1| PREDICTED: U-box domain-containing protein 4... 91 1e-16 emb|CBI33305.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_003635632.1| PREDICTED: U-box domain-containing protein 4... 91 1e-16 ref|XP_006352348.1| PREDICTED: U-box domain-containing protein 4... 91 2e-16 ref|XP_002528228.1| ubiquitin-protein ligase, putative [Ricinus ... 88 1e-15 gb|EXB56663.1| U-box domain-containing protein 4 [Morus notabilis] 88 2e-15 ref|XP_004293377.1| PREDICTED: U-box domain-containing protein 4... 87 3e-15 gb|EOY28903.1| ARM repeat superfamily protein isoform 1 [Theobro... 86 5e-15 gb|EPS73780.1| hypothetical protein M569_00975 [Genlisea aurea] 86 8e-15 gb|EMJ12820.1| hypothetical protein PRUPE_ppa005569mg [Prunus pe... 85 1e-14 ref|XP_006467322.1| PREDICTED: U-box domain-containing protein 4... 82 9e-14 ref|XP_004134799.1| PREDICTED: U-box domain-containing protein 4... 82 1e-13 ref|XP_004486322.1| PREDICTED: U-box domain-containing protein 4... 81 2e-13 ref|XP_003594249.1| U-box domain-containing protein [Medicago tr... 81 2e-13 ref|XP_003546191.1| PREDICTED: U-box domain-containing protein 4... 80 4e-13 ref|XP_003534872.1| PREDICTED: U-box domain-containing protein 4... 78 1e-12 gb|ESW26018.1| hypothetical protein PHAVU_003G084700g [Phaseolus... 77 3e-12 gb|ESW19636.1| hypothetical protein PHAVU_006G142100g [Phaseolus... 76 6e-12 >ref|XP_004236666.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 451 Score = 95.5 bits (236), Expect = 7e-18 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLRE PRQEASTSTP Sbjct: 402 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLRE-PRQEASTSTP 451 >ref|XP_004250274.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 459 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQ GTAKAKHKAETLL YLRE PRQEASTSTP Sbjct: 410 VRNRGLLVREGGIPPLVALSQNGTAKAKHKAETLLGYLRE-PRQEASTSTP 459 >ref|XP_006346779.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 451 Score = 91.3 bits (225), Expect = 1e-16 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLL YLRE RQEASTSTP Sbjct: 402 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLTYLRES-RQEASTSTP 451 >emb|CBI33305.3| unnamed protein product [Vitis vinifera] Length = 286 Score = 91.3 bits (225), Expect = 1e-16 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQTGTA+AKHKAETLL YLRE PRQEASTS+P Sbjct: 237 VRNRGLLVREGGIPPLVALSQTGTARAKHKAETLLGYLRE-PRQEASTSSP 286 >ref|XP_003635632.1| PREDICTED: U-box domain-containing protein 4-like [Vitis vinifera] gi|147866196|emb|CAN79837.1| hypothetical protein VITISV_007520 [Vitis vinifera] Length = 452 Score = 91.3 bits (225), Expect = 1e-16 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQTGTA+AKHKAETLL YLRE PRQEASTS+P Sbjct: 403 VRNRGLLVREGGIPPLVALSQTGTARAKHKAETLLGYLRE-PRQEASTSSP 452 >ref|XP_006352348.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 458 Score = 90.5 bits (223), Expect = 2e-16 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQ GTAKAKHKAETLL YLRE PRQEAS+STP Sbjct: 409 VRNRGLLVREGGIPPLVALSQNGTAKAKHKAETLLGYLRE-PRQEASSSTP 458 >ref|XP_002528228.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223532345|gb|EEF34143.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 467 Score = 88.2 bits (217), Expect = 1e-15 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQTGT +AKHKAETLL YLRE PRQEAS+S+P Sbjct: 418 VRNRGLLVREGGIPPLVALSQTGTVRAKHKAETLLGYLRE-PRQEASSSSP 467 >gb|EXB56663.1| U-box domain-containing protein 4 [Morus notabilis] Length = 455 Score = 87.8 bits (216), Expect = 2e-15 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQTG+ +AKHKAETLLAYLRE PRQEAS+S+P Sbjct: 406 VRNRGLLVREGGIPPLVALSQTGSMRAKHKAETLLAYLRE-PRQEASSSSP 455 >ref|XP_004293377.1| PREDICTED: U-box domain-containing protein 4-like [Fragaria vesca subsp. vesca] Length = 449 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQ+GT +AKHKAETLL YLRE PRQEAS+S+P Sbjct: 400 VRNRGLLVREGGIPPLVALSQSGTVRAKHKAETLLGYLRE-PRQEASSSSP 449 >gb|EOY28903.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] gi|508781648|gb|EOY28904.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 462 Score = 86.3 bits (212), Expect = 5e-15 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 +RNRGLLVREGGIPPLVALSQTG+ +AKHKAETLL YLRE PRQEAS+S+P Sbjct: 413 IRNRGLLVREGGIPPLVALSQTGSVRAKHKAETLLGYLRE-PRQEASSSSP 462 >gb|EPS73780.1| hypothetical protein M569_00975 [Genlisea aurea] Length = 452 Score = 85.5 bits (210), Expect = 8e-15 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLVREGGIPPLVALSQ GTAKAKHKAETLL YLRE ++ +S+STP Sbjct: 402 VRNRGLLVREGGIPPLVALSQNGTAKAKHKAETLLGYLREPRKEASSSSTP 452 >gb|EMJ12820.1| hypothetical protein PRUPE_ppa005569mg [Prunus persica] Length = 454 Score = 84.7 bits (208), Expect = 1e-14 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTS 406 VRNRGLLVREGGIPPLVALSQTGT +AKHKAETLL YLRE PRQEAS+S Sbjct: 405 VRNRGLLVREGGIPPLVALSQTGTLRAKHKAETLLGYLRE-PRQEASSS 452 >ref|XP_006467322.1| PREDICTED: U-box domain-containing protein 4-like [Citrus sinensis] Length = 464 Score = 82.0 bits (201), Expect = 9e-14 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 V+NRGLLVREGGIPPLVALSQTG+ +AKHKAETLL YLRE PRQE +S+P Sbjct: 415 VKNRGLLVREGGIPPLVALSQTGSVRAKHKAETLLGYLRE-PRQEGPSSSP 464 >ref|XP_004134799.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] gi|449524460|ref|XP_004169241.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] Length = 459 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 VRNRGLLV EGGIPPLVALSQTG+ +AKHKAETLL YLRE PRQ AS+S+P Sbjct: 410 VRNRGLLVSEGGIPPLVALSQTGSVRAKHKAETLLGYLRE-PRQVASSSSP 459 >ref|XP_004486322.1| PREDICTED: U-box domain-containing protein 4-like [Cicer arietinum] Length = 457 Score = 80.9 bits (198), Expect = 2e-13 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTST 403 V NRGLLVREGGIPPLVALSQ GT +AKHKAETLL YLRE RQEASTST Sbjct: 408 VTNRGLLVREGGIPPLVALSQNGTPRAKHKAETLLRYLRES-RQEASTST 456 >ref|XP_003594249.1| U-box domain-containing protein [Medicago truncatula] gi|355483297|gb|AES64500.1| U-box domain-containing protein [Medicago truncatula] Length = 460 Score = 80.9 bits (198), Expect = 2e-13 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTST 403 V NRGLLVREGGIPPLVALSQ GT +AKHKAETLL YLRE RQEASTST Sbjct: 411 VTNRGLLVREGGIPPLVALSQNGTPRAKHKAETLLRYLRES-RQEASTST 459 >ref|XP_003546191.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 457 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTST 403 VRNRG LVREGGIPPLVALSQTG+ +AKHKAETLL YLRE ++ ASTS+ Sbjct: 407 VRNRGFLVREGGIPPLVALSQTGSVRAKHKAETLLRYLRESRQEAASTSS 456 >ref|XP_003534872.1| PREDICTED: U-box domain-containing protein 4 [Glycine max] Length = 458 Score = 78.2 bits (191), Expect = 1e-12 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTST 403 V NRG LVREGGIPPLVALSQTG+A+AKHKAETLL YLRE PRQEA++++ Sbjct: 408 VINRGFLVREGGIPPLVALSQTGSARAKHKAETLLRYLRE-PRQEAASTS 456 >gb|ESW26018.1| hypothetical protein PHAVU_003G084700g [Phaseolus vulgaris] gi|561027379|gb|ESW26019.1| hypothetical protein PHAVU_003G084700g [Phaseolus vulgaris] Length = 436 Score = 77.0 bits (188), Expect = 3e-12 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTSTP 400 V NRGLLVREGGIPPLVALSQ G+ +AKHKAETLL YLRE R EAS S+P Sbjct: 387 VSNRGLLVREGGIPPLVALSQNGSVRAKHKAETLLGYLRES-RHEASCSSP 436 >gb|ESW19636.1| hypothetical protein PHAVU_006G142100g [Phaseolus vulgaris] Length = 457 Score = 75.9 bits (185), Expect = 6e-12 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -1 Query: 552 VRNRGLLVREGGIPPLVALSQTGTAKAKHKAETLLAYLREKPRQEASTST 403 + NRG LVREGGIPPLVALSQT + +AKHKAETLL YLRE RQEASTS+ Sbjct: 408 ITNRGFLVREGGIPPLVALSQTASVRAKHKAETLLRYLRES-RQEASTSS 456