BLASTX nr result
ID: Atropa21_contig00005269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00005269 (787 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuber... 72 2e-10 ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum] gi... 72 2e-10 gb|AAR14052.2| catalase [Solanum tuberosum] 72 2e-10 gb|AAM97541.1| catalase 2, partial [Capsicum annuum] 72 2e-10 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis] 70 8e-10 sp|P45739.1|CATA_HELAN RecName: Full=Catalase gi|453529|gb|AAA69... 70 8e-10 ref|NP_001235974.1| catalase-3 [Glycine max] gi|17865455|sp|O485... 70 8e-10 sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 gi|8624... 70 8e-10 sp|O24339.1|CATA_SOLAP RecName: Full=Catalase gi|2462661|emb|CAB... 70 8e-10 sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 gi|1848... 70 8e-10 sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1 gi|5367... 70 8e-10 ref|NP_001237571.1| catalase-4 [Glycine max] gi|17865456|sp|O485... 70 8e-10 dbj|BAA34714.1| catalase [Oryza sativa] 70 8e-10 ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha] 70 8e-10 ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X... 70 8e-10 ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X... 70 8e-10 gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima] 70 8e-10 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus... 70 8e-10 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus... 70 8e-10 ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citr... 70 8e-10 >ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum] Length = 492 Score = 72.4 bits (176), Expect = 2e-10 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK Sbjct: 38 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 72 >ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum] gi|17865474|sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 gi|5257185|gb|AAD41256.1| catalase 2 [Solanum lycopersicum] Length = 492 Score = 72.4 bits (176), Expect = 2e-10 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK Sbjct: 38 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 72 >gb|AAR14052.2| catalase [Solanum tuberosum] Length = 475 Score = 72.4 bits (176), Expect = 2e-10 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK Sbjct: 21 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 55 >gb|AAM97541.1| catalase 2, partial [Capsicum annuum] Length = 484 Score = 72.4 bits (176), Expect = 2e-10 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK Sbjct: 30 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 64 >gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >sp|P45739.1|CATA_HELAN RecName: Full=Catalase gi|453529|gb|AAA69866.1| catalase [Helianthus annuus] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >ref|NP_001235974.1| catalase-3 [Glycine max] gi|17865455|sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 gi|2661019|gb|AAB88171.1| catalase [Glycine max] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 gi|862452|dbj|BAA09506.1| catalase [Cucurbita pepo] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >sp|O24339.1|CATA_SOLAP RecName: Full=Catalase gi|2462661|emb|CAB16749.1| catalase [Soldanella alpina] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 gi|18488|emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1 gi|536783|emb|CAA85424.1| catalase [Nicotiana plumbaginifolia] Length = 485 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GPVLLEDYHLVEKLANFDRER+ ERVVHARGASAK Sbjct: 31 GPVLLEDYHLVEKLANFDRERVPERVVHARGASAK 65 >ref|NP_001237571.1| catalase-4 [Glycine max] gi|17865456|sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 gi|2661021|gb|AAB88172.1| catalase [Glycine max] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >dbj|BAA34714.1| catalase [Oryza sativa] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis] gi|568839649|ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis] gi|568839651|ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis] Length = 512 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 58 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 92 >gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72 >ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina] gi|557537485|gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina] Length = 492 Score = 70.1 bits (170), Expect = 8e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 683 GPVLLEDYHLVEKLANFDRERIAERVVHARGASAK 787 GP+LLEDYHLVEKLANFDRERI ERVVHARGASAK Sbjct: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAK 72