BLASTX nr result
ID: Atropa21_contig00004733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00004733 (908 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231102.1| PREDICTED: alpha-1,3-mannosyl-glycoprotein 2... 59 2e-06 ref|XP_004231101.1| PREDICTED: alpha-1,3-mannosyl-glycoprotein 2... 59 2e-06 emb|CAC80698.1| N-acetylglucosaminyltransferase I [Solanum tuber... 59 2e-06 >ref|XP_004231102.1| PREDICTED: alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like isoform 2 [Solanum lycopersicum] Length = 373 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 817 EHPRSIMAISSWNDNGQRQFVQDPYALYRS 906 + +SIMAISSWNDNGQRQFVQDPYALYRS Sbjct: 159 DRDKSIMAISSWNDNGQRQFVQDPYALYRS 188 >ref|XP_004231101.1| PREDICTED: alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like isoform 1 [Solanum lycopersicum] Length = 446 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 817 EHPRSIMAISSWNDNGQRQFVQDPYALYRS 906 + +SIMAISSWNDNGQRQFVQDPYALYRS Sbjct: 232 DRDKSIMAISSWNDNGQRQFVQDPYALYRS 261 >emb|CAC80698.1| N-acetylglucosaminyltransferase I [Solanum tuberosum] Length = 431 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 817 EHPRSIMAISSWNDNGQRQFVQDPYALYRS 906 + +SIMAISSWNDNGQRQFVQDPYALYRS Sbjct: 217 DRDKSIMAISSWNDNGQRQFVQDPYALYRS 246