BLASTX nr result
ID: Atropa21_contig00004627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00004627 (956 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243929.1| PREDICTED: pentatricopeptide repeat-containi... 108 4e-21 ref|XP_006342394.1| PREDICTED: pentatricopeptide repeat-containi... 107 5e-21 ref|XP_002269136.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-14 gb|EMJ02980.1| hypothetical protein PRUPE_ppa001132mg [Prunus pe... 83 1e-13 gb|EOY02481.1| Pentatricopeptide repeat-containing protein, puta... 83 2e-13 gb|EPS63256.1| hypothetical protein M569_11526, partial [Genlise... 82 2e-13 ref|XP_002532584.1| pentatricopeptide repeat-containing protein,... 82 4e-13 ref|XP_004172369.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 75 4e-11 ref|XP_004144802.1| PREDICTED: pentatricopeptide repeat-containi... 75 4e-11 emb|CAN76479.1| hypothetical protein VITISV_028175 [Vitis vinifera] 75 5e-11 ref|XP_004952031.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-10 ref|XP_004291546.1| PREDICTED: pentatricopeptide repeat-containi... 70 9e-10 ref|XP_003617158.1| Pentatricopeptide repeat-containing protein ... 70 9e-10 dbj|BAD08027.1| putative pentatricopeptide (PPR) repeat-containi... 69 2e-09 ref|XP_003573904.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|NP_001045762.2| Os02g0127600 [Oryza sativa Japonica Group] g... 69 2e-09 ref|XP_002451457.1| hypothetical protein SORBIDRAFT_04g002270 [S... 69 2e-09 gb|EEC72399.1| hypothetical protein OsI_05688 [Oryza sativa Indi... 69 2e-09 ref|XP_006648271.1| PREDICTED: pentatricopeptide repeat-containi... 69 3e-09 ref|XP_003545174.1| PREDICTED: pentatricopeptide repeat-containi... 68 6e-09 >ref|XP_004243929.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Solanum lycopersicum] Length = 896 Score = 108 bits (269), Expect = 4e-21 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 ERLCKKGYEPNRWTYDILVHGFLK GR SEARRWM+EMFSKGFDLTEATK+FV Sbjct: 844 ERLCKKGYEPNRWTYDILVHGFLKVGRSSEARRWMEEMFSKGFDLTEATKSFV 896 >ref|XP_006342394.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X1 [Solanum tuberosum] gi|565350891|ref|XP_006342395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X2 [Solanum tuberosum] Length = 895 Score = 107 bits (268), Expect = 5e-21 Identities = 49/53 (92%), Positives = 50/53 (94%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 ERLCKKGYEPNRWTYDILVHGFLK GR SEARRWM+EMFSKGFDLTEATK FV Sbjct: 843 ERLCKKGYEPNRWTYDILVHGFLKVGRSSEARRWMEEMFSKGFDLTEATKTFV 895 >ref|XP_002269136.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Vitis vinifera] Length = 881 Score = 86.7 bits (213), Expect = 1e-14 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = -1 Query: 953 RLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 R+C+KGYEPNRWTYDILVHG K GR SEA +W++EMF KGF+ TEATK + Sbjct: 830 RICQKGYEPNRWTYDILVHGLFKHGRTSEANKWVEEMFCKGFEPTEATKLLI 881 >gb|EMJ02980.1| hypothetical protein PRUPE_ppa001132mg [Prunus persica] Length = 899 Score = 83.2 bits (204), Expect = 1e-13 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -1 Query: 953 RLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 ++C+KGYEPNRWTYD LV GFLK GR SEARRW++ M+ KGF TE TK F+ Sbjct: 848 KICQKGYEPNRWTYDTLVQGFLKHGRTSEARRWLEVMYRKGFHPTERTKLFI 899 >gb|EOY02481.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 885 Score = 82.8 bits (203), Expect = 2e-13 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 950 LCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 +C+KGYEPNRWTYDI+VH L+ GR EA RW++EMF KGFDLTE TK + Sbjct: 835 ICQKGYEPNRWTYDIIVHSLLRKGRRDEASRWVEEMFRKGFDLTENTKLLI 885 >gb|EPS63256.1| hypothetical protein M569_11526, partial [Genlisea aurea] Length = 816 Score = 82.4 bits (202), Expect = 2e-13 Identities = 33/50 (66%), Positives = 45/50 (90%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATK 807 +R+ ++GY PNRWTYDI+VHGF+KDGR +EA+ W+++M S+GFDLTEATK Sbjct: 766 DRMIQRGYVPNRWTYDIIVHGFVKDGRITEAKSWIEKMISRGFDLTEATK 815 >ref|XP_002532584.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527693|gb|EEF29801.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 895 Score = 81.6 bits (200), Expect = 4e-13 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 +R+C+KGYEPN WTYDILVHG K+GR EARRW+DEMF KGF + TK+ + Sbjct: 843 DRICQKGYEPNHWTYDILVHGLFKNGRIGEARRWVDEMFRKGFSPSGRTKSLM 895 >ref|XP_004172369.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g71210-like, partial [Cucumis sativus] Length = 889 Score = 75.1 bits (183), Expect = 4e-11 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 +RLC+KGY PN+WTYDILVHG K GR EA+R ++ M KGF LTE T+A + Sbjct: 828 DRLCEKGYVPNKWTYDILVHGLFKQGRTVEAKRLLEIMHKKGFSLTECTQALI 880 >ref|XP_004144802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Cucumis sativus] Length = 913 Score = 75.1 bits (183), Expect = 4e-11 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAFV 798 +RLC+KGY PN+WTYDILVHG K GR EA+R ++ M KGF LTE T+A + Sbjct: 852 DRLCEKGYVPNKWTYDILVHGLFKQGRTVEAKRLLEIMHKKGFSLTECTQALI 904 >emb|CAN76479.1| hypothetical protein VITISV_028175 [Vitis vinifera] Length = 1173 Score = 74.7 bits (182), Expect = 5e-11 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 953 RLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKG 831 R+C+KGYEPNRWTYDILVHG K GR SEA +W++EMF KG Sbjct: 830 RICQKGYEPNRWTYDILVHGLFKHGRTSEANKWVEEMFCKG 870 >ref|XP_004952031.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Setaria italica] Length = 914 Score = 73.2 bits (178), Expect = 1e-10 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 ER+C+KGY+PNRWT+DI+VHGF K+G +EA RWMD M+ GF Sbjct: 846 ERMCRKGYQPNRWTFDIMVHGFCKNGDRNEAERWMDAMYRNGF 888 >ref|XP_004291546.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Fragaria vesca subsp. vesca] Length = 630 Score = 70.5 bits (171), Expect = 9e-10 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 953 RLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATKAF 801 R+ +KGYEPNRWTYDILV GFLK GR EA W+ M+ KGF TE F Sbjct: 579 RMSQKGYEPNRWTYDILVQGFLKHGRTDEANLWLKAMYEKGFSPTEQRMRF 629 >ref|XP_003617158.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355518493|gb|AET00117.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 978 Score = 70.5 bits (171), Expect = 9e-10 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -1 Query: 953 RLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGFDLTEATK 807 R+C++G +PN WTYD +V GFL GR EA++W++EM KGFDLT++T+ Sbjct: 830 RMCQRGCKPNGWTYDFMVRGFLNHGRNDEAKQWVEEMHQKGFDLTDSTR 878 >dbj|BAD08027.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] Length = 903 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 ERLC+KGYEPNRWT+DI+VHGF K+ EA RWM+ M GF Sbjct: 835 ERLCRKGYEPNRWTFDIMVHGFCKNSDRDEAERWMEAMHRNGF 877 >ref|XP_003573904.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform 1 [Brachypodium distachyon] gi|357146190|ref|XP_003573905.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform 2 [Brachypodium distachyon] Length = 905 Score = 69.3 bits (168), Expect = 2e-09 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 ERLC+KGY+PNRWT+D +VHGF + G +EA RWM+ M+ GF Sbjct: 836 ERLCRKGYQPNRWTFDTMVHGFCRHGNRNEAERWMEAMYRNGF 878 >ref|NP_001045762.2| Os02g0127600 [Oryza sativa Japonica Group] gi|255670569|dbj|BAF07676.2| Os02g0127600 [Oryza sativa Japonica Group] Length = 886 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 ERLC+KGYEPNRWT+DI+VHGF K+ EA RWM+ M GF Sbjct: 818 ERLCRKGYEPNRWTFDIMVHGFCKNSDRDEAERWMEAMHRNGF 860 >ref|XP_002451457.1| hypothetical protein SORBIDRAFT_04g002270 [Sorghum bicolor] gi|241931288|gb|EES04433.1| hypothetical protein SORBIDRAFT_04g002270 [Sorghum bicolor] Length = 917 Score = 69.3 bits (168), Expect = 2e-09 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 ER+C++GY+PNRWT+DI+VHGF K G +EA RWMD ++ GF Sbjct: 849 ERICRQGYQPNRWTFDIIVHGFCKIGDKNEAERWMDALYRNGF 891 >gb|EEC72399.1| hypothetical protein OsI_05688 [Oryza sativa Indica Group] Length = 831 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 ERLC+KGYEPNRWT+DI+VHGF K+ EA RWM+ M GF Sbjct: 763 ERLCRKGYEPNRWTFDIMVHGFCKNSDRDEAERWMEAMHRNGF 805 >ref|XP_006648271.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like, partial [Oryza brachyantha] Length = 784 Score = 68.9 bits (167), Expect = 3e-09 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 956 ERLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 E+LC+KGYEPNRWT+DI++HG+ K+G EA RWM+ M GF Sbjct: 716 EKLCRKGYEPNRWTFDIMIHGYCKNGDRDEAERWMEAMHRNGF 758 >ref|XP_003545174.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X1 [Glycine max] gi|571507027|ref|XP_006595790.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X2 [Glycine max] gi|571507030|ref|XP_006595791.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X3 [Glycine max] gi|571507034|ref|XP_006595792.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X4 [Glycine max] gi|571507038|ref|XP_006595793.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X5 [Glycine max] Length = 868 Score = 67.8 bits (164), Expect = 6e-09 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -1 Query: 953 RLCKKGYEPNRWTYDILVHGFLKDGRPSEARRWMDEMFSKGF 828 R+C++GY+PN WTYDI+V GF GR EARRW++EMF KGF Sbjct: 822 RMCQRGYQPNCWTYDIMVRGFSIHGRKHEARRWLEEMFRKGF 863