BLASTX nr result
ID: Atropa21_contig00004626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00004626 (616 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243929.1| PREDICTED: pentatricopeptide repeat-containi... 105 8e-21 ref|XP_006342394.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_002269136.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 gb|EMJ02980.1| hypothetical protein PRUPE_ppa001132mg [Prunus pe... 81 3e-13 gb|EOY02481.1| Pentatricopeptide repeat-containing protein, puta... 80 3e-13 gb|EPS63256.1| hypothetical protein M569_11526, partial [Genlise... 80 5e-13 ref|XP_002532584.1| pentatricopeptide repeat-containing protein,... 77 5e-12 ref|XP_003617158.1| Pentatricopeptide repeat-containing protein ... 76 9e-12 ref|XP_004172369.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 73 7e-11 ref|XP_004144802.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 emb|CAN76479.1| hypothetical protein VITISV_028175 [Vitis vinifera] 72 9e-11 ref|XP_004952031.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_004291546.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 dbj|BAD08027.1| putative pentatricopeptide (PPR) repeat-containi... 67 4e-09 ref|XP_003573904.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|NP_001045762.2| Os02g0127600 [Oryza sativa Japonica Group] g... 67 4e-09 gb|EEC72399.1| hypothetical protein OsI_05688 [Oryza sativa Indi... 67 4e-09 ref|XP_006648271.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_003545174.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_002451457.1| hypothetical protein SORBIDRAFT_04g002270 [S... 64 3e-08 >ref|XP_004243929.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Solanum lycopersicum] Length = 896 Score = 105 bits (263), Expect = 8e-21 Identities = 49/53 (92%), Positives = 50/53 (94%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 ERLCKKG EPNRWTYDILVHGFLK GR SEARRWMEEMFSKGFDLTEATK+FV Sbjct: 844 ERLCKKGYEPNRWTYDILVHGFLKVGRSSEARRWMEEMFSKGFDLTEATKSFV 896 >ref|XP_006342394.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X1 [Solanum tuberosum] gi|565350891|ref|XP_006342395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X2 [Solanum tuberosum] Length = 895 Score = 105 bits (262), Expect = 1e-20 Identities = 49/53 (92%), Positives = 49/53 (92%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 ERLCKKG EPNRWTYDILVHGFLK GR SEARRWMEEMFSKGFDLTEATK FV Sbjct: 843 ERLCKKGYEPNRWTYDILVHGFLKVGRSSEARRWMEEMFSKGFDLTEATKTFV 895 >ref|XP_002269136.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Vitis vinifera] Length = 881 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -1 Query: 613 RLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 R+C+KG EPNRWTYDILVHG K GR SEA +W+EEMF KGF+ TEATK + Sbjct: 830 RICQKGYEPNRWTYDILVHGLFKHGRTSEANKWVEEMFCKGFEPTEATKLLI 881 >gb|EMJ02980.1| hypothetical protein PRUPE_ppa001132mg [Prunus persica] Length = 899 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -1 Query: 613 RLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 ++C+KG EPNRWTYD LV GFLK GR SEARRW+E M+ KGF TE TK F+ Sbjct: 848 KICQKGYEPNRWTYDTLVQGFLKHGRTSEARRWLEVMYRKGFHPTERTKLFI 899 >gb|EOY02481.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 885 Score = 80.5 bits (197), Expect = 3e-13 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 610 LCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 +C+KG EPNRWTYDI+VH L+ GR EA RW+EEMF KGFDLTE TK + Sbjct: 835 ICQKGYEPNRWTYDIIVHSLLRKGRRDEASRWVEEMFRKGFDLTENTKLLI 885 >gb|EPS63256.1| hypothetical protein M569_11526, partial [Genlisea aurea] Length = 816 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATK 467 +R+ ++G PNRWTYDI+VHGF+KDGR +EA+ W+E+M S+GFDLTEATK Sbjct: 766 DRMIQRGYVPNRWTYDIIVHGFVKDGRITEAKSWIEKMISRGFDLTEATK 815 >ref|XP_002532584.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527693|gb|EEF29801.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 895 Score = 76.6 bits (187), Expect = 5e-12 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 +R+C+KG EPN WTYDILVHG K+GR EARRW++EMF KGF + TK+ + Sbjct: 843 DRICQKGYEPNHWTYDILVHGLFKNGRIGEARRWVDEMFRKGFSPSGRTKSLM 895 >ref|XP_003617158.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355518493|gb|AET00117.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 978 Score = 75.9 bits (185), Expect = 9e-12 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -1 Query: 613 RLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATK 467 R+C++GC+PN WTYD +V GFL GR EA++W+EEM KGFDLT++T+ Sbjct: 830 RMCQRGCKPNGWTYDFMVRGFLNHGRNDEAKQWVEEMHQKGFDLTDSTR 878 >ref|XP_004172369.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g71210-like, partial [Cucumis sativus] Length = 889 Score = 72.8 bits (177), Expect = 7e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 +RLC+KG PN+WTYDILVHG K GR EA+R +E M KGF LTE T+A + Sbjct: 828 DRLCEKGYVPNKWTYDILVHGLFKQGRTVEAKRLLEIMHKKGFSLTECTQALI 880 >ref|XP_004144802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Cucumis sativus] Length = 913 Score = 72.8 bits (177), Expect = 7e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAFV 458 +RLC+KG PN+WTYDILVHG K GR EA+R +E M KGF LTE T+A + Sbjct: 852 DRLCEKGYVPNKWTYDILVHGLFKQGRTVEAKRLLEIMHKKGFSLTECTQALI 904 >emb|CAN76479.1| hypothetical protein VITISV_028175 [Vitis vinifera] Length = 1173 Score = 72.4 bits (176), Expect = 9e-11 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 613 RLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKG 491 R+C+KG EPNRWTYDILVHG K GR SEA +W+EEMF KG Sbjct: 830 RICQKGYEPNRWTYDILVHGLFKHGRTSEANKWVEEMFCKG 870 >ref|XP_004952031.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Setaria italica] Length = 914 Score = 68.2 bits (165), Expect = 2e-09 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 ER+C+KG +PNRWT+DI+VHGF K+G +EA RWM+ M+ GF Sbjct: 846 ERMCRKGYQPNRWTFDIMVHGFCKNGDRNEAERWMDAMYRNGF 888 >ref|XP_004291546.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Fragaria vesca subsp. vesca] Length = 630 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 613 RLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGFDLTEATKAF 461 R+ +KG EPNRWTYDILV GFLK GR EA W++ M+ KGF TE F Sbjct: 579 RMSQKGYEPNRWTYDILVQGFLKHGRTDEANLWLKAMYEKGFSPTEQRMRF 629 >dbj|BAD08027.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] Length = 903 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 ERLC+KG EPNRWT+DI+VHGF K+ EA RWME M GF Sbjct: 835 ERLCRKGYEPNRWTFDIMVHGFCKNSDRDEAERWMEAMHRNGF 877 >ref|XP_003573904.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform 1 [Brachypodium distachyon] gi|357146190|ref|XP_003573905.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform 2 [Brachypodium distachyon] Length = 905 Score = 67.0 bits (162), Expect = 4e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 ERLC+KG +PNRWT+D +VHGF + G +EA RWME M+ GF Sbjct: 836 ERLCRKGYQPNRWTFDTMVHGFCRHGNRNEAERWMEAMYRNGF 878 >ref|NP_001045762.2| Os02g0127600 [Oryza sativa Japonica Group] gi|255670569|dbj|BAF07676.2| Os02g0127600 [Oryza sativa Japonica Group] Length = 886 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 ERLC+KG EPNRWT+DI+VHGF K+ EA RWME M GF Sbjct: 818 ERLCRKGYEPNRWTFDIMVHGFCKNSDRDEAERWMEAMHRNGF 860 >gb|EEC72399.1| hypothetical protein OsI_05688 [Oryza sativa Indica Group] Length = 831 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 ERLC+KG EPNRWT+DI+VHGF K+ EA RWME M GF Sbjct: 763 ERLCRKGYEPNRWTFDIMVHGFCKNSDRDEAERWMEAMHRNGF 805 >ref|XP_006648271.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like, partial [Oryza brachyantha] Length = 784 Score = 66.6 bits (161), Expect = 5e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 E+LC+KG EPNRWT+DI++HG+ K+G EA RWME M GF Sbjct: 716 EKLCRKGYEPNRWTFDIMIHGYCKNGDRDEAERWMEAMHRNGF 758 >ref|XP_003545174.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X1 [Glycine max] gi|571507027|ref|XP_006595790.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X2 [Glycine max] gi|571507030|ref|XP_006595791.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X3 [Glycine max] gi|571507034|ref|XP_006595792.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X4 [Glycine max] gi|571507038|ref|XP_006595793.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like isoform X5 [Glycine max] Length = 868 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 613 RLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 R+C++G +PN WTYDI+V GF GR EARRW+EEMF KGF Sbjct: 822 RMCQRGYQPNCWTYDIMVRGFSIHGRKHEARRWLEEMFRKGF 863 >ref|XP_002451457.1| hypothetical protein SORBIDRAFT_04g002270 [Sorghum bicolor] gi|241931288|gb|EES04433.1| hypothetical protein SORBIDRAFT_04g002270 [Sorghum bicolor] Length = 917 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -1 Query: 616 ERLCKKGCEPNRWTYDILVHGFLKDGRPSEARRWMEEMFSKGF 488 ER+C++G +PNRWT+DI+VHGF K G +EA RWM+ ++ GF Sbjct: 849 ERICRQGYQPNRWTFDIIVHGFCKIGDKNEAERWMDALYRNGF 891