BLASTX nr result
ID: Atractylodes22_contig00054701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054701 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39148.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_003599496.1| F-box [Medicago truncatula] gi|355488544|gb|... 58 9e-07 ref|XP_002467649.1| hypothetical protein SORBIDRAFT_01g031620 [S... 58 9e-07 ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycin... 57 1e-06 ref|XP_003623994.1| F-box protein [Medicago truncatula] gi|35549... 57 2e-06 >emb|CBI39148.3| unnamed protein product [Vitis vinifera] Length = 711 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 241 PDSLLIEILARLPVKSIFRFKCVCKHWQTLISHPSFRGFH 122 P+ ++++IL+RLPVKS+ RF+CVCK W TLISHP F H Sbjct: 5 PEVIMVDILSRLPVKSLLRFRCVCKAWCTLISHPQFVETH 44 >ref|XP_003599496.1| F-box [Medicago truncatula] gi|355488544|gb|AES69747.1| F-box [Medicago truncatula] Length = 370 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -3 Query: 241 PDSLLIEILARLPVKSIFRFKCVCKHWQTLISHPSFRGFH 122 P L+I+IL RLPVKS+ RFKCVCK W TLIS P F H Sbjct: 10 PHELIIQILLRLPVKSLIRFKCVCKSWLTLISDPHFAKSH 49 >ref|XP_002467649.1| hypothetical protein SORBIDRAFT_01g031620 [Sorghum bicolor] gi|241921503|gb|EER94647.1| hypothetical protein SORBIDRAFT_01g031620 [Sorghum bicolor] Length = 201 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 238 DSLLIEILARLPVKSIFRFKCVCKHWQTLISHPSFR 131 D L++EIL+RLPVKS+ RFKCV KHW LISHP R Sbjct: 17 DDLIVEILSRLPVKSVCRFKCVSKHWLGLISHPDHR 52 >ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycine max] gi|255637050|gb|ACU18857.1| unknown [Glycine max] Length = 406 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 241 PDSLLIEILARLPVKSIFRFKCVCKHWQTLISHPSFRGFH 122 PD L++EIL+RLPVKS+ +F+CVCK W +LIS P F H Sbjct: 50 PDELVVEILSRLPVKSLLQFRCVCKSWMSLISDPYFMKKH 89 >ref|XP_003623994.1| F-box protein [Medicago truncatula] gi|355499009|gb|AES80212.1| F-box protein [Medicago truncatula] Length = 249 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 241 PDSLLIEILARLPVKSIFRFKCVCKHWQTLISHPSFRGFH 122 PD L+ E+L+ LPVKS RFKCVCK W+TLIS+P+F H Sbjct: 7 PDDLITELLSFLPVKSPVRFKCVCKSWKTLISNPNFVKLH 46