BLASTX nr result
ID: Atractylodes22_contig00054622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054622 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFU82548.1| disease resistance protein RGA2, partial [Artemis... 65 8e-09 >gb|AFU82548.1| disease resistance protein RGA2, partial [Artemisia tridentata] Length = 182 Score = 64.7 bits (156), Expect = 8e-09 Identities = 42/98 (42%), Positives = 57/98 (58%), Gaps = 1/98 (1%) Frame = +2 Query: 2 ESLCLVGLKNDDIPISQVKHLAICRDPDMSFEIKISFENMISKVFKEKMMARTLQTLSFD 181 ESLCL+ +D++ +S VKHL++ ++ D S + K+ M +RTL TL Sbjct: 11 ESLCLLVPTSDEVHMSHVKHLSLHQERD-------------SNLLKD-MASRTLHTLFLR 56 Query: 182 GEVENISFHNFKCLRILSFS-GCKLKKIHDSIGELVHL 292 G V ISF +FKCLRIL S L I DS+G+LVHL Sbjct: 57 GVVTKISFQDFKCLRILKLSRNYALTGIDDSVGDLVHL 94