BLASTX nr result
ID: Atractylodes22_contig00054570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054570 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30414.3| unnamed protein product [Vitis vinifera] 57 1e-06 >emb|CBI30414.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/76 (35%), Positives = 48/76 (63%), Gaps = 2/76 (2%) Frame = +2 Query: 149 WPDYYFIYNHRLLFVLGLVFSHSLTNYAITNVLIWYFTDYGED--LATSAIYSNIHGSLS 322 W YYF+++ L + LVFSHSL +A+ +VL+ Y TD ++ L +A+ N + S Sbjct: 13 WFQYYFVFSKAALLISALVFSHSLVEHAVVDVLMSYITDTWKNVHLNVAAVAVNTYEVTS 72 Query: 323 SLLVIFMANAADSFVG 370 ++ V+ +A+A+D++ G Sbjct: 73 TIAVVLLAHASDAYFG 88