BLASTX nr result
ID: Atractylodes22_contig00054563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054563 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517126.1| pentatricopeptide repeat-containing protein,... 64 1e-08 ref|XP_004168898.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 62 6e-08 ref|XP_004134445.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_003536531.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 emb|CBI26264.3| unnamed protein product [Vitis vinifera] 60 1e-07 >ref|XP_002517126.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543761|gb|EEF45289.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 463 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +2 Query: 107 MTSAALDMLASLLQSAVSTRSSVLGRATHARIIKSIHFPFPIFICNHLVNMY 262 M S + LA +L+SA+STRSS LGRATHARIIK+ P P F+ NHL++MY Sbjct: 1 MPSFTPNSLAPILESAISTRSSFLGRATHARIIKTFQSPLPPFLSNHLISMY 52 >ref|XP_004168898.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g14850-like [Cucumis sativus] Length = 606 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +2 Query: 131 LASLLQSAVSTRSSVLGRATHARIIKSIHFPFPIFICNHLVNMY 262 LAS+++ AVS RSS+LGRA HA+I+K++ PFP F+ NHLVNMY Sbjct: 9 LASVVELAVSVRSSLLGRAAHAQILKTLKTPFPAFLYNHLVNMY 52 >ref|XP_004134445.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like [Cucumis sativus] Length = 606 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +2 Query: 131 LASLLQSAVSTRSSVLGRATHARIIKSIHFPFPIFICNHLVNMY 262 LAS+++ AVS RSS+LGRA HA+I+K++ PFP F+ NHLVNMY Sbjct: 9 LASVVELAVSVRSSLLGRAAHAQILKTLKTPFPAFLYNHLVNMY 52 >ref|XP_003536531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like [Glycine max] Length = 686 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +2 Query: 125 DMLASLLQSAVSTRSSVLGRATHARIIKSIHFPFPIFICNHLVNMY 262 ++L S L+SAV +RSS+LGRA HA I+++ P P F+CNHLVNMY Sbjct: 8 NLLGSFLESAVLSRSSLLGRAVHAHILRTHDTPLPSFLCNHLVNMY 53 >emb|CBI26264.3| unnamed protein product [Vitis vinifera] Length = 583 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +2 Query: 131 LASLLQSAVSTRSSVLGRATHARIIKSIHFPFPIFICNHLVNMY 262 LASL++SAVST+ S LGRA HA+IIK++ P P FI NHLVNMY Sbjct: 9 LASLVESAVSTQCSRLGRAAHAQIIKTLDNPLPSFIYNHLVNMY 52