BLASTX nr result
ID: Atractylodes22_contig00053229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053229 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63156.1| Retrotransposon gag protein [Asparagus officinalis] 38 6e-06 >gb|ABD63156.1| Retrotransposon gag protein [Asparagus officinalis] Length = 275 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 17/42 (40%), Positives = 29/42 (69%) Frame = -1 Query: 127 LLKSF*KKYVPPTRNAKCRDAISHFRQYDDETVPDACERFKE 2 L ++F KY PP++ A+ R+ I+ F Q + E++ DA ER+K+ Sbjct: 40 LSEAFLAKYFPPSKTAQLRNQITTFTQKEGESLYDAWERYKD 81 Score = 37.0 bits (84), Expect(2) = 6e-06 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 185 KVKVWLNSLERGSVTSWDVLAEKFLKK 105 K + WL SL GS+T+WD L+E FL K Sbjct: 21 KARAWLQSLPPGSITTWDQLSEAFLAK 47