BLASTX nr result
ID: Atractylodes22_contig00050360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050360 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275508.1| PREDICTED: uncharacterized protein LOC100260... 55 4e-06 emb|CBI25338.3| unnamed protein product [Vitis vinifera] 55 6e-06 >ref|XP_002275508.1| PREDICTED: uncharacterized protein LOC100260478 [Vitis vinifera] Length = 539 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/63 (42%), Positives = 44/63 (69%) Frame = -1 Query: 190 DFRTQNAHLEAEKAKVVELQKEVADLDLVIFDSNGKISIMGEELEACRAKLLTAEDEISK 11 + Q A+LE EK +V+ELQK+ A+L+ + +S+ KI ++ EELE + +L+ +E+E K Sbjct: 220 EIEMQEANLELEKRQVLELQKQTAELENRVSESDHKICMLEEELEETKKRLMGSEEENEK 279 Query: 10 LKH 2 LKH Sbjct: 280 LKH 282 >emb|CBI25338.3| unnamed protein product [Vitis vinifera] Length = 227 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/59 (45%), Positives = 43/59 (72%) Frame = -1 Query: 178 QNAHLEAEKAKVVELQKEVADLDLVIFDSNGKISIMGEELEACRAKLLTAEDEISKLKH 2 Q A+LE EK +V+ELQK+ A+L+ + +S+ KI ++ EELE + +L+ +E+E KLKH Sbjct: 2 QEANLELEKRQVLELQKQTAELENRVSESDHKICMLEEELEETKKRLMGSEEENEKLKH 60