BLASTX nr result
ID: Atractylodes22_contig00049973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049973 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517599.1| ubiquitin-protein ligase, putative [Ricinus ... 57 1e-06 ref|XP_002304150.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002517599.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223543231|gb|EEF44763.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 367 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +2 Query: 146 MWNHLPSDLLANIFSYLPPHSLARAMATCRHWH 244 MW+ LP DLLANIFS+L P SLARA + CRHWH Sbjct: 1 MWSSLPFDLLANIFSFLSPDSLARARSACRHWH 33 >ref|XP_002304150.1| predicted protein [Populus trichocarpa] gi|222841582|gb|EEE79129.1| predicted protein [Populus trichocarpa] Length = 375 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +2 Query: 146 MWNHLPSDLLANIFSYLPPHSLARAMATCRHW 241 MWN LPS+LLANIFS+L P SLARA CR+W Sbjct: 1 MWNRLPSELLANIFSFLSPDSLARAKTACRYW 32