BLASTX nr result
ID: Atractylodes22_contig00045448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045448 (555 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD32333.1| polyprotein-like, putative [Medicago truncatula] 62 3e-09 ref|XP_003545301.1| PREDICTED: uncharacterized protein LOC100820... 56 4e-09 ref|XP_003555650.1| PREDICTED: uncharacterized protein LOC100817... 63 3e-08 ref|XP_003549005.1| PREDICTED: uncharacterized protein LOC100789... 52 1e-07 gb|ABD32757.1| Integrase, catalytic region [Medicago truncatula] 55 2e-07 >gb|ABD32333.1| polyprotein-like, putative [Medicago truncatula] Length = 635 Score = 62.0 bits (149), Expect(2) = 3e-09 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 4/90 (4%) Frame = +3 Query: 237 TSVRKSTRVHRSP-YLKDYHCNLVQEKY---NKGNVLYPLSKNLGYELLTGRQKESALAL 404 +++R S+R +SP YL+DY CN NK +LYPLS + ++ L+ Q AL+L Sbjct: 35 STLRVSSRTKKSPSYLQDYICNPSTNSVSSANKSCILYPLSNFISHKHLSNSQHTFALSL 94 Query: 405 TVNVEPKSYK*AIESGEWVQAMNDELAVME 494 ++EPKSY AI+S W QAM EL ++ Sbjct: 95 VSHIEPKSYAEAIKSDCWKQAMQLELNALD 124 Score = 24.3 bits (51), Expect(2) = 3e-09 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 505 TWSVVDLPEGKKHVRCR 555 TW+VVD+P K + C+ Sbjct: 128 TWTVVDIPSQVKPIGCK 144 >ref|XP_003545301.1| PREDICTED: uncharacterized protein LOC100820591 [Glycine max] Length = 1057 Score = 55.8 bits (133), Expect(2) = 4e-09 Identities = 33/88 (37%), Positives = 51/88 (57%), Gaps = 1/88 (1%) Frame = +3 Query: 243 VRKSTRVHRSP-YLKDYHCNLVQEKYNKGNVLYPLSKNLGYELLTGRQKESALALTVNVE 419 +R+ST+V +P YL D+HC V + NK V YP+ +L Y L+ K ++ N E Sbjct: 437 LRRSTKVSNTPKYLIDFHCYNVT-RTNK--VTYPIQHHLDYSKLSNSHKHYICQISENHE 493 Query: 420 PKSYK*AIESGEWVQAMNDELAVMEANQ 503 P++Y AI+ W +A++ EL ME N+ Sbjct: 494 PQTYSQAIKHKPWQEAISTELMAMELNK 521 Score = 30.0 bits (66), Expect(2) = 4e-09 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 Query: 493 KLIKTWSVVDLPEGKKHVRCR 555 +L KTW++V P+GKK + C+ Sbjct: 518 ELNKTWTIVPFPQGKKPISCK 538 >ref|XP_003555650.1| PREDICTED: uncharacterized protein LOC100817175 [Glycine max] Length = 2045 Score = 63.2 bits (152), Expect = 3e-08 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 3/121 (2%) Frame = +3 Query: 147 NLDSRTDLEDCG-EPTYEEPVMKEGVVDANVTSVRKSTRVHRSP-YLKDYHCNLVQEKYN 320 NLD + +E+C +PT P E + + +R+STR +P YL+DYH +L N Sbjct: 1183 NLDPQ--IENCSSQPTISVPSSNEPSNEQPLPHLRRSTRAKNTPTYLQDYHRDLASSTPN 1240 Query: 321 KGNVL-YPLSKNLGYELLTGRQKESALALTVNVEPKSYK*AIESGEWVQAMNDELAVMEA 497 ++ YPLS L Y L+ + +++++ EP SY A W++AM EL +++ Sbjct: 1241 TSAIVRYPLSSVLSYSRLSPAHRNFVMSISLTAEPTSYTEASRHDCWIKAMKVELQALQS 1300 Query: 498 N 500 N Sbjct: 1301 N 1301 >ref|XP_003549005.1| PREDICTED: uncharacterized protein LOC100789964 [Glycine max] Length = 2412 Score = 51.6 bits (122), Expect(2) = 1e-07 Identities = 33/83 (39%), Positives = 43/83 (51%), Gaps = 4/83 (4%) Frame = +3 Query: 246 RKSTRVHRSP-YLKDYHCNLVQE---KYNKGNVLYPLSKNLGYELLTGRQKESALALTVN 413 RKS R+ + P YL +YHCNL+ N G YPLS L Y+ + K L+ + Sbjct: 1114 RKSHRLTKPPAYLFEYHCNLLSSILSASNPGKSPYPLSSVLSYDKCSPCHKRFCLSFSSL 1173 Query: 414 VEPKSYK*AIESGEWVQAMNDEL 482 EPK+YK A + W AM EL Sbjct: 1174 TEPKTYKQACKFDCWNLAMKSEL 1196 Score = 28.9 bits (63), Expect(2) = 1e-07 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 505 TWSVVDLPEGKKHVRCR 555 TWSVVDL EGK+ + C+ Sbjct: 1204 TWSVVDLHEGKQPIGCK 1220 >gb|ABD32757.1| Integrase, catalytic region [Medicago truncatula] Length = 1157 Score = 55.1 bits (131), Expect(2) = 2e-07 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 4/87 (4%) Frame = +3 Query: 246 RKSTRV-HRSPYLKDYHCNLVQEKYNKGN---VLYPLSKNLGYELLTGRQKESALALTVN 413 R S+R+ H P+ KDY C + N V YP+S L Y L+ AL+LT + Sbjct: 794 RISSRIKHSPPHFKDYICQSSSSSSSNNNTHVVSYPISHYLSYNKLSNDHLHFALSLTTH 853 Query: 414 VEPKSYK*AIESGEWVQAMNDELAVME 494 EPKSY A + W +AM ELA +E Sbjct: 854 TEPKSYTEASKFDCWNKAMETELAALE 880 Score = 25.4 bits (54), Expect(2) = 2e-07 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 499 IKTWSVVDLPEGKKHVRCR 555 I TW +VDLP K + CR Sbjct: 882 IGTWKLVDLPPNIKPIGCR 900