BLASTX nr result
ID: Atractylodes22_contig00042713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042713 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004151941.1| PREDICTED: uncharacterized protein LOC101209... 55 5e-06 ref|XP_002529332.1| hypothetical protein RCOM_1016710 [Ricinus c... 55 5e-06 >ref|XP_004151941.1| PREDICTED: uncharacterized protein LOC101209977 [Cucumis sativus] gi|449490349|ref|XP_004158579.1| PREDICTED: uncharacterized protein LOC101227497 [Cucumis sativus] Length = 367 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/62 (45%), Positives = 37/62 (59%) Frame = -2 Query: 187 MDFDVLTDLIN*AQIGFREGTGLSSFDPKDTILPSLPTVEAFIFTLDSSPLYLR*KYCKG 8 M +++ DLI QI R +SS+DP LP+LP+ I LD SP YLR K+CKG Sbjct: 1 MAYEIPRDLIKQLQISLRNEANISSYDPHHPSLPNLPSFNETIADLDPSPPYLRCKHCKG 60 Query: 7 KL 2 +L Sbjct: 61 RL 62 >ref|XP_002529332.1| hypothetical protein RCOM_1016710 [Ricinus communis] gi|223531203|gb|EEF33049.1| hypothetical protein RCOM_1016710 [Ricinus communis] Length = 467 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/62 (45%), Positives = 40/62 (64%) Frame = -2 Query: 187 MDFDVLTDLIN*AQIGFREGTGLSSFDPKDTILPSLPTVEAFIFTLDSSPLYLR*KYCKG 8 M F++ D I QI R+ GL+S+DP+D LP+LP+++ I L+ SP YLR K C G Sbjct: 1 MAFEMPYDQIKELQISLRKEAGLASYDPEDPSLPNLPSLQDAISELEPSPSYLRCKSCNG 60 Query: 7 KL 2 +L Sbjct: 61 RL 62