BLASTX nr result
ID: Atractylodes22_contig00041831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041831 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 82 2e-24 ref|XP_002868452.1| predicted protein [Arabidopsis lyrata subsp.... 60 8e-09 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 82.0 bits (201), Expect(2) = 2e-24 Identities = 41/45 (91%), Positives = 41/45 (91%) Frame = -1 Query: 433 PRYRTCDSHRIRLAQRLLNSSRAFSSTSPLQSSIKLAFPRRYEMG 299 PRYRTCDSHRIRLAQRLLN SRAFSST PLQSSIKLAF RR EMG Sbjct: 30 PRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQSSIKLAFSRRSEMG 74 Score = 55.1 bits (131), Expect(2) = 2e-24 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 300 GVFPSPIVCIGLASYRTKEAFWRARACRKADDYIS 196 GVFPSPIVCIGLAS R+K + RARACRKAD YIS Sbjct: 74 GVFPSPIVCIGLASSRSK-LYLRARACRKADHYIS 107 >ref|XP_002868452.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314288|gb|EFH44711.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 96 Score = 60.1 bits (144), Expect(2) = 8e-09 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 5/52 (9%) Frame = +1 Query: 190 LLAYIVVGLPTRTRPPECLLGSV*SQA----DTYDRRRKDPP-FHSAWGTQV 330 LLAY++VGLPTRTRPPECLL V +A YDRRRKDP F+SAW + + Sbjct: 14 LLAYVMVGLPTRTRPPECLLFVVLDEAKPIHTIYDRRRKDPHLFNSAWASLI 65 Score = 24.6 bits (52), Expect(2) = 8e-09 Identities = 13/20 (65%), Positives = 13/20 (65%), Gaps = 3/20 (15%) Frame = +3 Query: 324 ASLIEDWRG---EVEEKARD 374 ASLIEDWRG VE RD Sbjct: 62 ASLIEDWRGYMPAVESLGRD 81