BLASTX nr result
ID: Atractylodes22_contig00040388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040388 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271644.2| PREDICTED: endoplasmic oxidoreductin-1-like ... 73 2e-11 emb|CBI30934.3| unnamed protein product [Vitis vinifera] 73 2e-11 ref|XP_002317004.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 ref|XP_002457565.1| hypothetical protein SORBIDRAFT_03g009470 [S... 70 2e-10 ref|XP_002298934.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 >ref|XP_002271644.2| PREDICTED: endoplasmic oxidoreductin-1-like [Vitis vinifera] Length = 487 Score = 73.2 bits (178), Expect = 2e-11 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 127 PCRCSEDSHKYTGIVEDCCCDYETVDSVNGAVLYPLLQELVT 2 PC C +D+HKY+G+VEDCCCDY TVD +N VL+P+LQELVT Sbjct: 45 PCHCGKDAHKYSGMVEDCCCDYVTVDHLNEEVLHPILQELVT 86 >emb|CBI30934.3| unnamed protein product [Vitis vinifera] Length = 499 Score = 73.2 bits (178), Expect = 2e-11 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 127 PCRCSEDSHKYTGIVEDCCCDYETVDSVNGAVLYPLLQELVT 2 PC C +D+HKY+G+VEDCCCDY TVD +N VL+P+LQELVT Sbjct: 45 PCHCGKDAHKYSGMVEDCCCDYVTVDHLNEEVLHPILQELVT 86 >ref|XP_002317004.1| predicted protein [Populus trichocarpa] gi|222860069|gb|EEE97616.1| predicted protein [Populus trichocarpa] Length = 470 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 124 CRCSEDSHKYTGIVEDCCCDYETVDSVNGAVLYPLLQELVT 2 C S+DS KY G++EDCCCDYE+VDSVNG VL+PLLQELVT Sbjct: 64 CPSSQDSGKYKGVIEDCCCDYESVDSVNGEVLHPLLQELVT 104 >ref|XP_002457565.1| hypothetical protein SORBIDRAFT_03g009470 [Sorghum bicolor] gi|241929540|gb|EES02685.1| hypothetical protein SORBIDRAFT_03g009470 [Sorghum bicolor] Length = 595 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = -1 Query: 130 SPCRCS--EDSHKYTGIVEDCCCDYETVDSVNGAVLYPLLQELV 5 SPCRC + + KYTG+VEDCCCDYETVD++N VL+P+LQELV Sbjct: 94 SPCRCGPFQAARKYTGMVEDCCCDYETVDAINEEVLHPILQELV 137 >ref|XP_002298934.1| predicted protein [Populus trichocarpa] gi|222846192|gb|EEE83739.1| predicted protein [Populus trichocarpa] Length = 481 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -1 Query: 124 CRCSEDS-HKYTGIVEDCCCDYETVDSVNGAVLYPLLQELVT 2 C+CS KY G++EDCCCDYE+VDSVNG VL+PLLQELVT Sbjct: 62 CQCSSAQVRKYKGMIEDCCCDYESVDSVNGEVLHPLLQELVT 103