BLASTX nr result
ID: Atractylodes22_contig00040280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040280 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002460138.1| hypothetical protein SORBIDRAFT_02g023240 [S... 84 2e-14 >ref|XP_002460138.1| hypothetical protein SORBIDRAFT_02g023240 [Sorghum bicolor] gi|241923515|gb|EER96659.1| hypothetical protein SORBIDRAFT_02g023240 [Sorghum bicolor] Length = 338 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/58 (60%), Positives = 49/58 (84%) Frame = -2 Query: 232 NTIKDDDFWDDVGNVLAITKPIFLVIKFCDGDGSKMGEIYERMDNMLGEIKDVMKENT 59 +TI D++FW++V N+LA +PI+ V++F DG+G KMGEIYERMDNM+GEIKD+M + T Sbjct: 269 DTINDENFWNEVDNILAFIEPIYSVLRFSDGEGPKMGEIYERMDNMVGEIKDIMTQVT 326