BLASTX nr result
ID: Atractylodes22_contig00040214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040214 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280444.1| PREDICTED: uncharacterized protein LOC100254... 59 4e-07 ref|XP_002514212.1| transferase, transferring pentosyl groups, p... 58 7e-07 ref|XP_003567399.1| PREDICTED: uncharacterized protein C3F10.06c... 58 1e-06 ref|XP_002325024.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_004157886.1| PREDICTED: uncharacterized protein C3F10.06c... 57 2e-06 >ref|XP_002280444.1| PREDICTED: uncharacterized protein LOC100254132 [Vitis vinifera] gi|297738758|emb|CBI28003.3| unnamed protein product [Vitis vinifera] Length = 520 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -2 Query: 523 MRQRLIFLCKFAINARPSRGNLKQVFNFLAGANL 422 MR+RL+F+CK+A+NARPSRGNLKQVF+FL+G + Sbjct: 483 MRRRLVFICKYAVNARPSRGNLKQVFSFLSGGRV 516 >ref|XP_002514212.1| transferase, transferring pentosyl groups, putative [Ricinus communis] gi|223546668|gb|EEF48166.1| transferase, transferring pentosyl groups, putative [Ricinus communis] Length = 529 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 523 MRQRLIFLCKFAINARPSRGNLKQVFNFLAG 431 MR+RL+F+CKFA+NARPSRGNLKQVF FL G Sbjct: 480 MRRRLVFICKFAVNARPSRGNLKQVFAFLTG 510 >ref|XP_003567399.1| PREDICTED: uncharacterized protein C3F10.06c-like [Brachypodium distachyon] Length = 539 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -2 Query: 523 MRQRLIFLCKFAINARPSRGNLKQVFNFLAGANLGPCC 410 MR+RL+F+CK+AINARPSRGNL+QV+ FL CC Sbjct: 502 MRKRLVFICKYAINARPSRGNLRQVYGFLCNEKAQLCC 539 >ref|XP_002325024.1| predicted protein [Populus trichocarpa] gi|222866458|gb|EEF03589.1| predicted protein [Populus trichocarpa] Length = 503 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 523 MRQRLIFLCKFAINARPSRGNLKQVFNFLAGAN 425 MR+RL+F+CKFAI ARPSRGNLKQVF FL G + Sbjct: 467 MRRRLVFVCKFAITARPSRGNLKQVFGFLTGGS 499 >ref|XP_004157886.1| PREDICTED: uncharacterized protein C3F10.06c-like [Cucumis sativus] Length = 520 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -2 Query: 523 MRQRLIFLCKFAINARPSRGNLKQVFNFLAG 431 M++RL+++CKFA NARPSRGNL+QVFNFL+G Sbjct: 486 MKRRLVYICKFATNARPSRGNLRQVFNFLSG 516