BLASTX nr result
ID: Atractylodes22_contig00040208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040208 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525300.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 ref|XP_002320007.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002525300.1| conserved hypothetical protein [Ricinus communis] gi|223535458|gb|EEF37128.1| conserved hypothetical protein [Ricinus communis] Length = 501 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = -3 Query: 376 KDSRGWVELGGSST---EDSDPLTIEHAGSGQVSIDNSETKESSDWLDV-DIDV 227 KD R WV+L SS +D +P+ ++H GS QVS NS++KES+DWLDV DIDV Sbjct: 447 KDPRDWVQLSESSALSVKDINPVAVKHVGSEQVSARNSDSKESNDWLDVDDIDV 500 >ref|XP_002320007.1| predicted protein [Populus trichocarpa] gi|222860780|gb|EEE98322.1| predicted protein [Populus trichocarpa] Length = 506 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = -3 Query: 376 KDSRGWVELGGSSTE---DSDPLTIEHAGSGQVSIDNSETKESSDWLDV-DIDV 227 K S+ WV+L SS + D P++I++AGS +VS NSE KESSDWLDV DIDV Sbjct: 452 KGSQDWVQLSRSSADSVKDIKPVSIKNAGSEKVSARNSENKESSDWLDVDDIDV 505