BLASTX nr result
ID: Atractylodes22_contig00040064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040064 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW73911.1| 26S protease regulatory subunit 6A [Zea mays] 56 2e-08 ref|XP_003570339.1| PREDICTED: 26S protease regulatory subunit 6... 56 2e-08 gb|ADB28898.1| 26S protease regulatory subunit-like protein [Lol... 56 2e-08 ref|XP_003564237.1| PREDICTED: 26S protease regulatory subunit 6... 56 2e-08 ref|XP_002436575.1| hypothetical protein SORBIDRAFT_10g005010 [S... 56 2e-08 >gb|AFW73911.1| 26S protease regulatory subunit 6A [Zea mays] Length = 449 Score = 55.8 bits (133), Expect(2) = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 208 IIFIDEIDVIGRKWFDSEVRGDREVQQTMLELL 110 IIFIDEID IG K FDSEV GDREVQ+TMLELL Sbjct: 271 IIFIDEIDAIGTKRFDSEVSGDREVQRTMLELL 303 Score = 27.7 bits (60), Expect(2) = 2e-08 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 110 NKLDGFSGDERIKAL 66 N+LDGFS DERIK + Sbjct: 304 NQLDGFSSDERIKVI 318 >ref|XP_003570339.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Brachypodium distachyon] Length = 434 Score = 55.8 bits (133), Expect(2) = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 208 IIFIDEIDVIGRKWFDSEVRGDREVQQTMLELL 110 IIFIDEID IG K FDSEV GDREVQ+TMLELL Sbjct: 277 IIFIDEIDAIGTKRFDSEVSGDREVQRTMLELL 309 Score = 27.7 bits (60), Expect(2) = 2e-08 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 110 NKLDGFSGDERIKAL 66 N+LDGFS DERIK + Sbjct: 310 NQLDGFSSDERIKVI 324 >gb|ADB28898.1| 26S protease regulatory subunit-like protein [Lolium perenne] Length = 433 Score = 55.8 bits (133), Expect(2) = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 208 IIFIDEIDVIGRKWFDSEVRGDREVQQTMLELL 110 IIFIDEID IG K FDSEV GDREVQ+TMLELL Sbjct: 276 IIFIDEIDAIGTKRFDSEVSGDREVQRTMLELL 308 Score = 27.7 bits (60), Expect(2) = 2e-08 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 110 NKLDGFSGDERIKAL 66 N+LDGFS DERIK + Sbjct: 309 NQLDGFSSDERIKVI 323 >ref|XP_003564237.1| PREDICTED: 26S protease regulatory subunit 6A homolog isoform 1 [Brachypodium distachyon] Length = 432 Score = 55.8 bits (133), Expect(2) = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 208 IIFIDEIDVIGRKWFDSEVRGDREVQQTMLELL 110 IIFIDEID IG K FDSEV GDREVQ+TMLELL Sbjct: 275 IIFIDEIDAIGTKRFDSEVSGDREVQRTMLELL 307 Score = 27.7 bits (60), Expect(2) = 2e-08 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 110 NKLDGFSGDERIKAL 66 N+LDGFS DERIK + Sbjct: 308 NQLDGFSSDERIKVI 322 >ref|XP_002436575.1| hypothetical protein SORBIDRAFT_10g005010 [Sorghum bicolor] gi|241914798|gb|EER87942.1| hypothetical protein SORBIDRAFT_10g005010 [Sorghum bicolor] Length = 430 Score = 55.8 bits (133), Expect(2) = 2e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 208 IIFIDEIDVIGRKWFDSEVRGDREVQQTMLELL 110 IIFIDEID IG K FDSEV GDREVQ+TMLELL Sbjct: 273 IIFIDEIDAIGTKRFDSEVSGDREVQRTMLELL 305 Score = 27.7 bits (60), Expect(2) = 2e-08 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 110 NKLDGFSGDERIKAL 66 N+LDGFS DERIK + Sbjct: 306 NQLDGFSSDERIKVI 320