BLASTX nr result
ID: Atractylodes22_contig00040016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040016 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACA13386.1| beta-amyrin synthase [Artemisia annua] 85 7e-15 gb|ACB87531.1| beta-amyrin synthase [Artemisia annua] 82 6e-14 sp|F8WQD0.1|SHS1_ASTTA RecName: Full=Shionone synthase; Short=At... 76 2e-12 gb|AAX14716.1| beta-amyrin synthase [Aster sedifolius] 75 7e-12 ref|XP_003632933.1| PREDICTED: germanicol synthase-like [Vitis v... 75 7e-12 >gb|ACA13386.1| beta-amyrin synthase [Artemisia annua] Length = 761 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/49 (75%), Positives = 37/49 (75%) Frame = -2 Query: 317 NNFVGRQIWEFDPNYGTPXXXXXXXXXXADFWNHRQEVKPSSDVLWRMQ 171 NNFVGRQIWEFDPNYGTP DFWNHR EVKPSSDVLWRMQ Sbjct: 19 NNFVGRQIWEFDPNYGTPEERAEVEQARVDFWNHRHEVKPSSDVLWRMQ 67 >gb|ACB87531.1| beta-amyrin synthase [Artemisia annua] Length = 761 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/49 (73%), Positives = 36/49 (73%) Frame = -2 Query: 317 NNFVGRQIWEFDPNYGTPXXXXXXXXXXADFWNHRQEVKPSSDVLWRMQ 171 NNFVGRQIWEFD NYGTP DFWNHR EVKPSSDVLWRMQ Sbjct: 19 NNFVGRQIWEFDSNYGTPEERAEVEQARVDFWNHRHEVKPSSDVLWRMQ 67 >sp|F8WQD0.1|SHS1_ASTTA RecName: Full=Shionone synthase; Short=AtaSHS gi|340007143|dbj|BAK52535.1| shionone synthase [Aster tataricus] Length = 761 Score = 76.3 bits (186), Expect = 2e-12 Identities = 31/49 (63%), Positives = 33/49 (67%) Frame = -2 Query: 317 NNFVGRQIWEFDPNYGTPXXXXXXXXXXADFWNHRQEVKPSSDVLWRMQ 171 NNF+GRQ WEFDPNYGTP FWNHR E+KPS D LWRMQ Sbjct: 19 NNFIGRQTWEFDPNYGTPEERDEVEQARLHFWNHRHEIKPSGDTLWRMQ 67 >gb|AAX14716.1| beta-amyrin synthase [Aster sedifolius] Length = 761 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = -2 Query: 317 NNFVGRQIWEFDPNYGTPXXXXXXXXXXADFWNHRQEVKPSSDVLWRMQ 171 NN+VGRQIWEFDPNYGTP A+FWN+R +VK SSDVLWRMQ Sbjct: 19 NNYVGRQIWEFDPNYGTPEELAEVEQARAEFWNNRHKVKTSSDVLWRMQ 67 >ref|XP_003632933.1| PREDICTED: germanicol synthase-like [Vitis vinifera] Length = 69 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -2 Query: 317 NNFVGRQIWEFDPNYGTPXXXXXXXXXXADFWNHRQEVKPSSDVLWRMQV 168 NNFVGRQIWEFDP+YGTP +FW +R +VKPSSD+LWRMQV Sbjct: 19 NNFVGRQIWEFDPDYGTPEERNEVEAARENFWKNRYQVKPSSDLLWRMQV 68