BLASTX nr result
ID: Atractylodes22_contig00037050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037050 (606 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548180.1| PREDICTED: cleavage and polyadenylation spec... 60 3e-07 ref|XP_003548179.1| PREDICTED: cleavage and polyadenylation spec... 60 3e-07 ref|XP_002517902.1| cleavage and polyadenylation specificity fac... 60 3e-07 ref|XP_003590295.1| Cleavage and polyadenylation specificity fac... 60 4e-07 ref|XP_002268591.1| PREDICTED: cleavage and polyadenylation spec... 59 9e-07 >ref|XP_003548180.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2-like isoform 2 [Glycine max] Length = 743 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 110 LSYRVSINGFNLLRDCGWNDHFVLSLLQPLSRVVST 3 LSY VSI+GFN L DCGWNDHF SLLQPL+RV ST Sbjct: 19 LSYLVSIDGFNFLVDCGWNDHFDPSLLQPLARVAST 54 >ref|XP_003548179.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2-like isoform 1 [Glycine max] Length = 738 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 110 LSYRVSINGFNLLRDCGWNDHFVLSLLQPLSRVVST 3 LSY VSI+GFN L DCGWNDHF SLLQPL+RV ST Sbjct: 19 LSYLVSIDGFNFLVDCGWNDHFDPSLLQPLARVAST 54 >ref|XP_002517902.1| cleavage and polyadenylation specificity factor, putative [Ricinus communis] gi|223542884|gb|EEF44420.1| cleavage and polyadenylation specificity factor, putative [Ricinus communis] Length = 740 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 110 LSYRVSINGFNLLRDCGWNDHFVLSLLQPLSRVVST 3 LSY +SI+ FNLL DCGWNDHF SLLQPLSRV ST Sbjct: 19 LSYLISIDNFNLLIDCGWNDHFDPSLLQPLSRVAST 54 >ref|XP_003590295.1| Cleavage and polyadenylation specificity factor subunit [Medicago truncatula] gi|355479343|gb|AES60546.1| Cleavage and polyadenylation specificity factor subunit [Medicago truncatula] Length = 630 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 110 LSYRVSINGFNLLRDCGWNDHFVLSLLQPLSRVVST 3 LSY VSI+ FN+L DCGWNDHF SLLQPLSRV ST Sbjct: 19 LSYLVSIDSFNILIDCGWNDHFDPSLLQPLSRVAST 54 >ref|XP_002268591.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 2 [Vitis vinifera] gi|302143847|emb|CBI22708.3| unnamed protein product [Vitis vinifera] Length = 740 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 110 LSYRVSINGFNLLRDCGWNDHFVLSLLQPLSRVVST 3 LSY VSI+GFN L DCGWNDHF S LQPL+RV ST Sbjct: 19 LSYLVSIDGFNFLVDCGWNDHFDPSFLQPLARVAST 54