BLASTX nr result
ID: Atractylodes22_contig00036421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00036421 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534492.1| BRASSINOSTEROID INSENSITIVE 1-associated rec... 94 2e-17 dbj|BAD32780.1| somatic embryogenesis receptor kinase 1 [Citrus ... 92 3e-17 gb|AFS64763.1| protein kinase [Prunus persica] 92 3e-17 gb|AFP25206.1| somatic embryogenesis receptor-like kinase [Malus... 92 3e-17 gb|AFP25205.1| somatic embryogenesis receptor-like kinase [Malus... 92 3e-17 >ref|XP_002534492.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi|223525200|gb|EEF27892.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] Length = 661 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 RWDEWQKVEVLRQEVDLAPHPNSDWIVDSTENLHAVELSGPR 128 RWDEWQKVEVLRQE+DLAPHPNSDWIVDSTENLHAVELSGPR Sbjct: 568 RWDEWQKVEVLRQEIDLAPHPNSDWIVDSTENLHAVELSGPR 609 >dbj|BAD32780.1| somatic embryogenesis receptor kinase 1 [Citrus unshiu] Length = 621 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 RWDEWQKVEVLRQEVDLAPHPNSDWIVDSTENLHAVELSGPR 128 RWDEWQKVEVLRQEV+LAPHPNSDWIVDSTENLHAVELSGPR Sbjct: 580 RWDEWQKVEVLRQEVELAPHPNSDWIVDSTENLHAVELSGPR 621 >gb|AFS64763.1| protein kinase [Prunus persica] Length = 626 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 RWDEWQKVEVLRQEVDLAPHPNSDWIVDSTENLHAVELSGPR 128 RWDEWQKVEVLRQEV+LAPHPNSDWIVDSTENLHAVELSGPR Sbjct: 585 RWDEWQKVEVLRQEVELAPHPNSDWIVDSTENLHAVELSGPR 626 >gb|AFP25206.1| somatic embryogenesis receptor-like kinase [Malus hupehensis] Length = 626 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 RWDEWQKVEVLRQEVDLAPHPNSDWIVDSTENLHAVELSGPR 128 RWDEWQKVEVLRQEV+LAPHPNSDWIVDSTENLHAVELSGPR Sbjct: 585 RWDEWQKVEVLRQEVELAPHPNSDWIVDSTENLHAVELSGPR 626 >gb|AFP25205.1| somatic embryogenesis receptor-like kinase [Malus hupehensis] Length = 632 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 RWDEWQKVEVLRQEVDLAPHPNSDWIVDSTENLHAVELSGPR 128 RWDEWQKVEVLRQEV+LAPHPNSDWIVDSTENLHAVELSGPR Sbjct: 591 RWDEWQKVEVLRQEVELAPHPNSDWIVDSTENLHAVELSGPR 632