BLASTX nr result
ID: Atractylodes22_contig00034879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034879 (878 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_564352.1| uncharacterized protein [Arabidopsis thaliana] ... 56 1e-05 >ref|NP_564352.1| uncharacterized protein [Arabidopsis thaliana] gi|12320849|gb|AAG50559.1|AC073506_1 hypothetical protein [Arabidopsis thaliana] gi|16323184|gb|AAL15326.1| At1g30260/F12P21_9 [Arabidopsis thaliana] gi|21436007|gb|AAM51581.1| At1g30260/F12P21_9 [Arabidopsis thaliana] gi|332193079|gb|AEE31200.1| uncharacterized protein [Arabidopsis thaliana] Length = 97 Score = 56.2 bits (134), Expect = 1e-05 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = -3 Query: 873 FVSEVAPPQFVSVMRQHTTKILDTISEDEREVSMNEREAKITAFNSSFSSAPY 715 F++EVAPPQFV+VMR+ T K+LDTI E+EREV + ++FNS S+P+ Sbjct: 9 FITEVAPPQFVTVMRRRTAKVLDTIKEEEREVGTD--SIFPSSFNSKKISSPF 59